BLASTX nr result
ID: Mentha25_contig00025520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00025520 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26639.1| hypothetical protein MIMGU_mgv1a001204mg [Mimulus... 61 1e-07 >gb|EYU26639.1| hypothetical protein MIMGU_mgv1a001204mg [Mimulus guttatus] gi|604313309|gb|EYU26640.1| hypothetical protein MIMGU_mgv1a001204mg [Mimulus guttatus] Length = 866 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = -1 Query: 182 CCIRS--RNMASMAQSPASFTGNLALKPAASDLLGSLCNGICDVP 54 CCIR MASMAQSP FT NLALKP ASDLL SL NG+C VP Sbjct: 114 CCIRPIRGKMASMAQSPIPFTENLALKPTASDLLRSLTNGVCGVP 158