BLASTX nr result
ID: Mentha25_contig00024826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024826 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia... 63 4e-08 gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana] 61 1e-07 gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypo... 61 1e-07 gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypo... 61 1e-07 gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus... 61 2e-07 ref|XP_006354759.1| PREDICTED: biotin carboxyl carrier protein o... 60 2e-07 ref|XP_004493036.1| PREDICTED: biotin carboxyl carrier protein o... 60 3e-07 ref|XP_004241599.1| PREDICTED: biotin carboxyl carrier protein o... 60 3e-07 gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Mimulus... 60 4e-07 gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] 60 4e-07 ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of o... 60 4e-07 gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus... 59 5e-07 ref|XP_007037521.1| Biotin carboxyl carrier protein of acetyl-Co... 59 5e-07 ref|XP_006345777.1| PREDICTED: biotin carboxyl carrier protein o... 59 7e-07 ref|XP_006345776.1| PREDICTED: biotin carboxyl carrier protein o... 59 7e-07 ref|NP_001234322.1| biotin carboxylase carrier protein [Solanum ... 59 7e-07 gb|AFK47404.1| unknown [Medicago truncatula] 59 7e-07 ref|XP_003543944.1| PREDICTED: biotin carboxyl carrier protein o... 59 7e-07 ref|XP_003624197.1| Acetyl-CoA carboxylase biotin carboxyl carri... 59 7e-07 ref|XP_002526099.1| Biotin carboxyl carrier protein subunit of o... 59 7e-07 >gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa] Length = 283 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGTVVEI+AEDGKPVSVDTPLF+IEP Sbjct: 252 EIEADQSGTVVEIIAEDGKPVSVDTPLFVIEP 283 >gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana] Length = 281 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEILAED KPVSVDTPLF+IEP Sbjct: 250 EIEADQSGTIVEILAEDAKPVSVDTPLFVIEP 281 >gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEILAEDGKPVSVD PLF+IEP Sbjct: 248 EIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEILAEDGKPVSVD PLF+IEP Sbjct: 248 EIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] gi|604335830|gb|EYU39718.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] Length = 293 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEIL EDGKPVS+DTPLF+IEP Sbjct: 262 EIEADQSGTLVEILGEDGKPVSIDTPLFVIEP 293 >ref|XP_006354759.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Solanum tuberosum] Length = 258 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQ+GTVV+I+AEDGKPVSVDTPLF+IEP Sbjct: 227 EIEADQAGTVVDIVAEDGKPVSVDTPLFVIEP 258 >ref|XP_004493036.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Cicer arietinum] Length = 260 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEI+AED KPVSVDTPLF+IEP Sbjct: 229 EIEADQSGTIVEIVAEDAKPVSVDTPLFVIEP 260 >ref|XP_004241599.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Solanum lycopersicum] Length = 261 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQ+GT+V+I+AEDGKPVSVDTPLF+IEP Sbjct: 230 EIEADQAGTIVDIVAEDGKPVSVDTPLFVIEP 261 >gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Mimulus guttatus] Length = 288 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IE+D+SGT+VEI+AEDGKPVSVDTPLF+IEP Sbjct: 257 EIESDRSGTIVEIVAEDGKPVSVDTPLFVIEP 288 >gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] Length = 257 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VEILA+DGKPVSVD PLF+IEP Sbjct: 226 EIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257 >ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] Length = 315 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+VE L EDGKPVSVDTPLF+IEP Sbjct: 284 EIEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 >gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus guttatus] Length = 270 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGTV EI+A DGKPVSVDTPLFIIEP Sbjct: 239 EIEADQSGTVAEIVAADGKPVSVDTPLFIIEP 270 >ref|XP_007037521.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] gi|508774766|gb|EOY22022.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] Length = 269 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIE 240 +IE DQSGT+VEILAEDGKPVSVDTPLF+IE Sbjct: 238 EIEVDQSGTIVEILAEDGKPVSVDTPLFVIE 268 >ref|XP_006345777.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 285 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEAD+SGT+VE++AEDGKPVSVDTPLF+I+P Sbjct: 254 EIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285 >ref|XP_006345776.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 316 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEAD+SGT+VE++AEDGKPVSVDTPLF+I+P Sbjct: 285 EIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 316 >ref|NP_001234322.1| biotin carboxylase carrier protein [Solanum lycopersicum] gi|29169309|gb|AAO66472.1| biotin carboxylase carrier protein [Solanum lycopersicum] Length = 285 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEAD+SGT+VE++AEDGKPVSVDTPLF+I+P Sbjct: 254 EIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285 >gb|AFK47404.1| unknown [Medicago truncatula] Length = 276 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEAD+SGT+VEI+AED KPVSVDTPLF+IEP Sbjct: 245 EIEADKSGTIVEIIAEDAKPVSVDTPLFVIEP 276 >ref|XP_003543944.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Glycine max] Length = 276 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+ E+LAEDGKPVSVDTPLF+I P Sbjct: 245 EIEADQSGTIAEVLAEDGKPVSVDTPLFVIVP 276 >ref|XP_003624197.1| Acetyl-CoA carboxylase biotin carboxyl carrier protein [Medicago truncatula] gi|355499212|gb|AES80415.1| Acetyl-CoA carboxylase biotin carboxyl carrier protein [Medicago truncatula] Length = 276 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEAD+SGT+VEI+AED KPVSVDTPLF+IEP Sbjct: 245 EIEADKSGTIVEIIAEDAKPVSVDTPLFVIEP 276 >ref|XP_002526099.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) [Ricinus communis] gi|223534596|gb|EEF36293.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) [Ricinus communis] Length = 260 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 332 DIEADQSGTVVEILAEDGKPVSVDTPLFIIEP 237 +IEADQSGT+ E+LAEDGKPVSVDTPLF+I P Sbjct: 229 EIEADQSGTITEVLAEDGKPVSVDTPLFVIVP 260