BLASTX nr result
ID: Mentha25_contig00024412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024412 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39085.1| hypothetical protein MIMGU_mgv1a002416mg [Mimulus... 55 1e-05 >gb|EYU39085.1| hypothetical protein MIMGU_mgv1a002416mg [Mimulus guttatus] Length = 678 Score = 55.1 bits (131), Expect = 1e-05 Identities = 39/97 (40%), Positives = 47/97 (48%), Gaps = 4/97 (4%) Frame = +2 Query: 152 MTALLRSFPTVALCAKSSXXXXXX----TRRHCPKFNPLKLFHRRLYXXXXXXXXXXXXX 319 M+ LLRS P VAL AK S T R NP KL H+R + Sbjct: 1 MSLLLRSLPAVALRAKFSIPPRLPLLLLTFRRLNS-NPPKLLHKRAFYSIYASASPSETL 59 Query: 320 XXXXXXKTPSHSAAETNSNAMEWVSRTDFCGELSEPD 430 K P +AETN++ +EWV+RT CGELSEPD Sbjct: 60 SVPTP-KQPFPPSAETNADELEWVNRTALCGELSEPD 95