BLASTX nr result
ID: Mentha25_contig00024124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024124 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21329.1| hypothetical protein MIMGU_mgv1a020950mg [Mimulus... 61 2e-07 >gb|EYU21329.1| hypothetical protein MIMGU_mgv1a020950mg [Mimulus guttatus] Length = 207 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 358 SKAVENSEESEAKVD-DIDDFFDFSNENPSTLEWVTKFIEF 239 S VE S E E K D++DFFDFSNENPSTLEWVTKFIEF Sbjct: 165 SSGVEVSSEEEQKTRFDVNDFFDFSNENPSTLEWVTKFIEF 205