BLASTX nr result
ID: Mentha25_contig00024041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00024041 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309095.2| hypothetical protein POPTR_0006s09370g [Popu... 62 1e-07 ref|XP_006576600.1| PREDICTED: rop guanine nucleotide exchange f... 61 2e-07 ref|XP_006367662.1| PREDICTED: rop guanine nucleotide exchange f... 61 2e-07 ref|XP_004246389.1| PREDICTED: rop guanine nucleotide exchange f... 61 2e-07 ref|XP_002272910.2| PREDICTED: rop guanine nucleotide exchange f... 61 2e-07 emb|CBI30469.3| unnamed protein product [Vitis vinifera] 61 2e-07 gb|EXB36686.1| Rop guanine nucleotide exchange factor 1 [Morus n... 60 2e-07 ref|XP_006349487.1| PREDICTED: rop guanine nucleotide exchange f... 60 2e-07 ref|XP_004302692.1| PREDICTED: rop guanine nucleotide exchange f... 60 2e-07 ref|XP_007204968.1| hypothetical protein PRUPE_ppa002319mg [Prun... 60 2e-07 ref|XP_004249581.1| PREDICTED: rop guanine nucleotide exchange f... 60 2e-07 gb|AFL91131.1| Rho guanyl-nucleotide exchange factor 1, partial ... 60 2e-07 gb|AFL91130.1| Rho guanyl-nucleotide exchange factor 1, partial ... 60 2e-07 gb|AFL91129.1| Rho guanyl-nucleotide exchange factor 1, partial ... 60 2e-07 gb|AFL91127.1| Rho guanyl-nucleotide exchange factor 1, partial ... 60 2e-07 gb|AFL91125.1| Rho guanyl-nucleotide exchange factor 1, partial ... 60 2e-07 gb|AEE89676.1| RopGEF7b [Medicago truncatula] 60 2e-07 ref|XP_006480911.1| PREDICTED: rop guanine nucleotide exchange f... 60 3e-07 ref|XP_006429232.1| hypothetical protein CICLE_v10011191mg [Citr... 60 3e-07 ref|XP_006398663.1| hypothetical protein EUTSA_v10013145mg [Eutr... 60 3e-07 >ref|XP_002309095.2| hypothetical protein POPTR_0006s09370g [Populus trichocarpa] gi|550335855|gb|EEE92618.2| hypothetical protein POPTR_0006s09370g [Populus trichocarpa] Length = 610 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 169 KAMWRREMEWLLCVSDHIVELMPSWQTFPDGSKLEV 204 >ref|XP_006576600.1| PREDICTED: rop guanine nucleotide exchange factor 7-like [Glycine max] Length = 670 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LL VSDYIVELKP+WQTFPDGS+LEV Sbjct: 235 KAMWRREMECLLSVSDYIVELKPTWQTFPDGSKLEV 270 >ref|XP_006367662.1| PREDICTED: rop guanine nucleotide exchange factor 7-like [Solanum tuberosum] Length = 659 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 7 M*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 M +REME LLCVSDYIVEL PSWQTFPDG++LEV Sbjct: 230 MWRREMEWLLCVSDYIVELTPSWQTFPDGTKLEV 263 >ref|XP_004246389.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Solanum lycopersicum] Length = 661 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 7 M*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 M +REME LLCVSDYIVEL PSWQTFPDG++LEV Sbjct: 230 MWRREMEWLLCVSDYIVELTPSWQTFPDGTKLEV 263 >ref|XP_002272910.2| PREDICTED: rop guanine nucleotide exchange factor 1-like [Vitis vinifera] Length = 701 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 258 KAMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 293 >emb|CBI30469.3| unnamed protein product [Vitis vinifera] Length = 1231 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 788 KAMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 823 >gb|EXB36686.1| Rop guanine nucleotide exchange factor 1 [Morus notabilis] Length = 691 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 246 KLMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 281 >ref|XP_006349487.1| PREDICTED: rop guanine nucleotide exchange factor 7-like [Solanum tuberosum] Length = 692 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 253 KLMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 288 >ref|XP_004302692.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Fragaria vesca subsp. vesca] Length = 707 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 249 KLMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 284 >ref|XP_007204968.1| hypothetical protein PRUPE_ppa002319mg [Prunus persica] gi|462400610|gb|EMJ06167.1| hypothetical protein PRUPE_ppa002319mg [Prunus persica] Length = 687 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 244 KLMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 279 >ref|XP_004249581.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Solanum lycopersicum] Length = 679 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 240 KLMWRREMEWLLCVSDHIVELIPSWQTFPDGSKLEV 275 >gb|AFL91131.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] Length = 67 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +RE+E LLCVSDYIVEL PSWQT+PDGS+LEV Sbjct: 17 KSMWRREIEWLLCVSDYIVELIPSWQTYPDGSKLEV 52 >gb|AFL91130.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] Length = 54 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +RE+E LLCVSDYIVEL PSWQT+PDGS+LEV Sbjct: 17 KSMWRREIEWLLCVSDYIVELIPSWQTYPDGSKLEV 52 >gb|AFL91129.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] gi|390430631|gb|AFL91133.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] Length = 57 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +RE+E LLCVSDYIVEL PSWQT+PDGS+LEV Sbjct: 17 KSMWRREIEWLLCVSDYIVELIPSWQTYPDGSKLEV 52 >gb|AFL91127.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] Length = 67 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +RE+E LLCVSDYIVEL PSWQT+PDGS+LEV Sbjct: 17 KSMWRREIEWLLCVSDYIVELIPSWQTYPDGSKLEV 52 >gb|AFL91125.1| Rho guanyl-nucleotide exchange factor 1, partial [Helianthus annuus] Length = 67 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +RE+E LLCVSDYIVEL PSWQT+PDGS+LEV Sbjct: 17 KSMWRREIEWLLCVSDYIVELIPSWQTYPDGSKLEV 52 >gb|AEE89676.1| RopGEF7b [Medicago truncatula] Length = 542 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LLCVSD+IVE KP+WQTFPDGSR EV Sbjct: 152 KAMWQREMEWLLCVSDHIVEFKPTWQTFPDGSRFEV 187 >ref|XP_006480911.1| PREDICTED: rop guanine nucleotide exchange factor 7-like [Citrus sinensis] Length = 708 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 259 KAMWRREMEWFLCVSDHIVELTPSWQTFPDGSKLEV 294 >ref|XP_006429232.1| hypothetical protein CICLE_v10011191mg [Citrus clementina] gi|557531289|gb|ESR42472.1| hypothetical protein CICLE_v10011191mg [Citrus clementina] Length = 708 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K M +REME LCVSD+IVEL PSWQTFPDGS+LEV Sbjct: 259 KAMWRREMEWFLCVSDHIVELTPSWQTFPDGSKLEV 294 >ref|XP_006398663.1| hypothetical protein EUTSA_v10013145mg [Eutrema salsugineum] gi|557099753|gb|ESQ40116.1| hypothetical protein EUTSA_v10013145mg [Eutrema salsugineum] Length = 557 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 KKM*KREME*LLCVSDYIVELKPSWQTFPDGSRLEV 108 K+M +REME LLCVSD+IVE+ P+WQTFPDGS+LE+ Sbjct: 137 KEMWRREMEWLLCVSDHIVEMTPTWQTFPDGSKLEI 172