BLASTX nr result
ID: Mentha25_contig00023826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00023826 (557 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26733.1| hypothetical protein MIMGU_mgv1a009205mg [Mimulus... 110 2e-22 ref|XP_006362863.1| PREDICTED: bifunctional nitrilase/nitrile hy... 109 4e-22 ref|XP_004251080.1| PREDICTED: bifunctional nitrilase/nitrile hy... 109 4e-22 sp|Q42966.1|NRL4B_TOBAC RecName: Full=Bifunctional nitrilase/nit... 108 7e-22 ref|XP_006854746.1| hypothetical protein AMTR_s00030p00246840 [A... 107 2e-21 ref|XP_007015744.1| Nitrilase 4 isoform 2 [Theobroma cacao] gi|5... 107 2e-21 ref|XP_007015743.1| Bifunctional nitrilase/nitrile hydratase NIT... 107 2e-21 gb|EXB91244.1| Bifunctional nitrilase/nitrile hydratase NIT4A [M... 107 3e-21 ref|XP_007132470.1| hypothetical protein PHAVU_011G096700g [Phas... 107 3e-21 ref|XP_003538102.1| PREDICTED: bifunctional nitrilase/nitrile hy... 107 3e-21 gb|ABA01485.1| nitrilase-like protein NIT [Gossypium hirsutum] 106 3e-21 sp|Q42965.1|NRL4A_TOBAC RecName: Full=Bifunctional nitrilase/nit... 106 5e-21 ref|XP_004506205.1| PREDICTED: bifunctional nitrilase/nitrile hy... 106 5e-21 ref|XP_004173224.1| PREDICTED: bifunctional nitrilase/nitrile hy... 105 6e-21 ref|XP_004139500.1| PREDICTED: bifunctional nitrilase/nitrile hy... 105 6e-21 ref|XP_006481512.1| PREDICTED: bifunctional nitrilase/nitrile hy... 105 8e-21 ref|XP_006424151.1| hypothetical protein CICLE_v10028755mg [Citr... 105 8e-21 ref|XP_006424150.1| hypothetical protein CICLE_v10028755mg [Citr... 105 8e-21 gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|... 105 8e-21 emb|CBI28280.3| unnamed protein product [Vitis vinifera] 105 8e-21 >gb|EYU26733.1| hypothetical protein MIMGU_mgv1a009205mg [Mimulus guttatus] Length = 349 Score = 110 bits (275), Expect = 2e-22 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 ELMP+S+VC GGSVIISPSG VLAGPNYEGEALI+ADLD+GE+VRAKFDFDVVGHYAR Sbjct: 262 ELMPDSIVCAGGSVIISPSGTVLAGPNYEGEALITADLDIGEIVRAKFDFDVVGHYAR 319 >ref|XP_006362863.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like [Solanum tuberosum] Length = 351 Score = 109 bits (273), Expect = 4e-22 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSGAVLAGPNY+GEALISADLDLGE+VRAKFDFDVVGHYAR Sbjct: 262 DLTPDSVVCAGGSVIISPSGAVLAGPNYDGEALISADLDLGEIVRAKFDFDVVGHYAR 319 >ref|XP_004251080.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like [Solanum lycopersicum] Length = 351 Score = 109 bits (273), Expect = 4e-22 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSGAVLAGPNY+GEALISADLDLGE+VRAKFDFDVVGHYAR Sbjct: 262 DLTPDSVVCAGGSVIISPSGAVLAGPNYDGEALISADLDLGEIVRAKFDFDVVGHYAR 319 >sp|Q42966.1|NRL4B_TOBAC RecName: Full=Bifunctional nitrilase/nitrile hydratase NIT4B; Short=TNIT4B; AltName: Full=Cyanoalanine nitrilase B; AltName: Full=Nitrilase 4B gi|1181615|dbj|BAA11770.1| nitrilase [Nicotiana tabacum] Length = 348 Score = 108 bits (271), Expect = 7e-22 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+S+VC GGSVIISPSGAVLAGPNYEGEALISADLDLGE+ RAKFDFDVVGHYAR Sbjct: 261 DLTPDSIVCAGGSVIISPSGAVLAGPNYEGEALISADLDLGEIARAKFDFDVVGHYAR 318 >ref|XP_006854746.1| hypothetical protein AMTR_s00030p00246840 [Amborella trichopoda] gi|548858432|gb|ERN16213.1| hypothetical protein AMTR_s00030p00246840 [Amborella trichopoda] Length = 344 Score = 107 bits (268), Expect = 2e-21 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGSVIISPSGAVLAGPNYE EALISADLD GE+VRAKFDFDVVGHYAR Sbjct: 256 ELPPDSVVCSGGSVIISPSGAVLAGPNYEAEALISADLDFGEIVRAKFDFDVVGHYAR 313 >ref|XP_007015744.1| Nitrilase 4 isoform 2 [Theobroma cacao] gi|508786107|gb|EOY33363.1| Nitrilase 4 isoform 2 [Theobroma cacao] Length = 371 Score = 107 bits (268), Expect = 2e-21 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGSVIISPSGA+LAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 284 ELTPDSVVCAGGSVIISPSGAILAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 341 >ref|XP_007015743.1| Bifunctional nitrilase/nitrile hydratase NIT4 isoform 1 [Theobroma cacao] gi|508786106|gb|EOY33362.1| Bifunctional nitrilase/nitrile hydratase NIT4 isoform 1 [Theobroma cacao] Length = 538 Score = 107 bits (268), Expect = 2e-21 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGSVIISPSGA+LAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 451 ELTPDSVVCAGGSVIISPSGAILAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 508 >gb|EXB91244.1| Bifunctional nitrilase/nitrile hydratase NIT4A [Morus notabilis] Length = 349 Score = 107 bits (266), Expect = 3e-21 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSG VLAGPNY+GEALISADLDLGE+VRAKFDFDVVGHY+R Sbjct: 262 DLTPDSVVCAGGSVIISPSGTVLAGPNYDGEALISADLDLGEIVRAKFDFDVVGHYSR 319 >ref|XP_007132470.1| hypothetical protein PHAVU_011G096700g [Phaseolus vulgaris] gi|561005470|gb|ESW04464.1| hypothetical protein PHAVU_011G096700g [Phaseolus vulgaris] Length = 350 Score = 107 bits (266), Expect = 3e-21 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSGAVLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 263 DLTPDSVVCAGGSVIISPSGAVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 320 >ref|XP_003538102.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like [Glycine max] Length = 350 Score = 107 bits (266), Expect = 3e-21 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSGAVLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 263 DLTPDSVVCAGGSVIISPSGAVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 320 >gb|ABA01485.1| nitrilase-like protein NIT [Gossypium hirsutum] Length = 177 Score = 106 bits (265), Expect = 3e-21 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGSVIISPSGA+LAGPNY+GEALISADLD+GE+ RAKFDFDVVGHY+R Sbjct: 88 ELNPDSVVCAGGSVIISPSGAILAGPNYDGEALISADLDMGEIARAKFDFDVVGHYSR 145 >sp|Q42965.1|NRL4A_TOBAC RecName: Full=Bifunctional nitrilase/nitrile hydratase NIT4A; Short=TNIT4A; AltName: Full=Cyanoalanine nitrilase A; AltName: Full=Nitrilase 4A gi|1171482|dbj|BAA09645.1| nitrilase [Nicotiana tabacum] Length = 349 Score = 106 bits (264), Expect = 5e-21 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+S+VC GGSVIISPSGAVLAGPNY GEALISADLDLGE+ RAKFDFDVVGHYAR Sbjct: 262 DLTPDSIVCAGGSVIISPSGAVLAGPNYVGEALISADLDLGEIARAKFDFDVVGHYAR 319 >ref|XP_004506205.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like [Cicer arietinum] Length = 377 Score = 106 bits (264), Expect = 5e-21 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVI+SPSGAVLAGPNYEGEALISADLDLG++ RAKFDFDVVGHY R Sbjct: 290 DLTPDSVVCAGGSVIVSPSGAVLAGPNYEGEALISADLDLGDIARAKFDFDVVGHYGR 347 >ref|XP_004173224.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like, partial [Cucumis sativus] Length = 302 Score = 105 bits (263), Expect = 6e-21 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGS IISPSG +LAGPNY+GEALISADLDLGE+ RAKFDFDVVGHYAR Sbjct: 214 ELTPDSVVCAGGSAIISPSGTILAGPNYDGEALISADLDLGEIARAKFDFDVVGHYAR 271 >ref|XP_004139500.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like [Cucumis sativus] Length = 350 Score = 105 bits (263), Expect = 6e-21 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 EL P+SVVC GGS IISPSG +LAGPNY+GEALISADLDLGE+ RAKFDFDVVGHYAR Sbjct: 262 ELTPDSVVCAGGSAIISPSGTILAGPNYDGEALISADLDLGEIARAKFDFDVVGHYAR 319 >ref|XP_006481512.1| PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4A-like [Citrus sinensis] Length = 345 Score = 105 bits (262), Expect = 8e-21 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+S+VC GGSVIISPSG+VLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 258 DLTPDSIVCAGGSVIISPSGSVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 315 >ref|XP_006424151.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] gi|557526085|gb|ESR37391.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] Length = 320 Score = 105 bits (262), Expect = 8e-21 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+S+VC GGSVIISPSG+VLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 233 DLTPDSIVCAGGSVIISPSGSVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 290 >ref|XP_006424150.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] gi|557526084|gb|ESR37390.1| hypothetical protein CICLE_v10028755mg [Citrus clementina] Length = 345 Score = 105 bits (262), Expect = 8e-21 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+S+VC GGSVIISPSG+VLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 258 DLTPDSIVCAGGSVIISPSGSVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 315 >gb|AAT36331.1| nitrilase 4A [Lupinus angustifolius] gi|79082433|gb|ABB51979.1| nitrilase 4A [Lupinus angustifolius] Length = 349 Score = 105 bits (262), Expect = 8e-21 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = -3 Query: 552 LMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 L P+SVVC GGSVIISPSGAVLAGP+YEGEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 263 LTPDSVVCAGGSVIISPSGAVLAGPSYEGEALISADLDLGEIARAKFDFDVVGHYSR 319 >emb|CBI28280.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 105 bits (262), Expect = 8e-21 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -3 Query: 555 ELMPESVVCGGGSVIISPSGAVLAGPNYEGEALISADLDLGEVVRAKFDFDVVGHYAR 382 +L P+SVVC GGSVIISPSG VLAGPNY+GEALISADLDLGE+ RAKFDFDVVGHY+R Sbjct: 67 DLTPDSVVCAGGSVIISPSGTVLAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSR 124