BLASTX nr result
ID: Mentha25_contig00022726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022726 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31238.1| hypothetical protein MIMGU_mgv1a004965mg [Mimulus... 63 5e-08 ref|XP_003624282.1| Cysteine protease ATG4 [Medicago truncatula]... 60 4e-07 >gb|EYU31238.1| hypothetical protein MIMGU_mgv1a004965mg [Mimulus guttatus] Length = 502 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = +2 Query: 2 RATKLSDQSNGAPLFTIAETRSIPRSGGNHGVSRDDTAETGGS-GSENSGQEDDWQLL 172 RA++L DQSNGAPLFTIAETR++ + GN+ +D +EN QEDDWQLL Sbjct: 445 RASELIDQSNGAPLFTIAETRTLAKPAGNNNTEIEDKNNADNDLATENCAQEDDWQLL 502 >ref|XP_003624282.1| Cysteine protease ATG4 [Medicago truncatula] gi|147742964|sp|A2Q1V6.1|ATG4_MEDTR RecName: Full=Cysteine protease ATG4; AltName: Full=Autophagy-related protein 4 gi|124359485|gb|ABN05923.1| Peptidase C54 [Medicago truncatula] gi|355499297|gb|AES80500.1| Cysteine protease ATG4 [Medicago truncatula] Length = 487 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 5/62 (8%) Frame = +2 Query: 2 RATKLSDQSNGAPLFTIAETRSIPRSGGNHGVSRDDTA-ETGGSGSEN----SGQEDDWQ 166 RATKL+++SNGAPLFT+A++RS+P ++ VS DDT E S S N +G EDDWQ Sbjct: 426 RATKLAEESNGAPLFTVAQSRSLPMQVTSNSVSGDDTRFEEDDSLSMNLVNDAGNEDDWQ 485 Query: 167 LL 172 L Sbjct: 486 FL 487