BLASTX nr result
ID: Mentha25_contig00022711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022711 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30730.1| hypothetical protein MIMGU_mgv1a000555mg [Mimulus... 66 4e-09 gb|ACA13524.1| putative cyclic nucleotide-dependent protein kina... 57 3e-06 ref|XP_004513027.1| PREDICTED: protein phosphatase 2C and cyclic... 56 6e-06 >gb|EYU30730.1| hypothetical protein MIMGU_mgv1a000555mg [Mimulus guttatus] Length = 1080 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +1 Query: 1 GLAERRVAVPSDIISRINLYMETHPDDVVTLASSPIREFKEAEAPEWLEDW 153 GLA+R V VP +IISRI LY+E+H DD + SP R+ +E PEWLEDW Sbjct: 1030 GLADRTVPVPPEIISRIKLYLESHSDDTESSVYSPTRDLEELNTPEWLEDW 1080 >gb|ACA13524.1| putative cyclic nucleotide-dependent protein kinase isoform B variant 2 [Nicotiana tabacum] Length = 579 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/50 (48%), Positives = 34/50 (68%) Frame = +1 Query: 4 LAERRVAVPSDIISRINLYMETHPDDVVTLASSPIREFKEAEAPEWLEDW 153 +A+ R VP++I+SRI+ +E H DD + SPIR+ +E PEWLEDW Sbjct: 530 VADHRSPVPAEILSRISQRLENHGDDNIASLHSPIRDLEELNTPEWLEDW 579 >ref|XP_004513027.1| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein-like [Cicer arietinum] Length = 1078 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/51 (45%), Positives = 30/51 (58%) Frame = +1 Query: 1 GLAERRVAVPSDIISRINLYMETHPDDVVTLASSPIREFKEAEAPEWLEDW 153 G+ VP++IISRI Y+E H +D SP+ E +E PEWLEDW Sbjct: 1028 GIRHHTFPVPTEIISRITQYLEAHSEDYTASIGSPLHEVEELNVPEWLEDW 1078