BLASTX nr result
ID: Mentha25_contig00022687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022687 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Mimulus... 60 2e-07 >gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Mimulus guttatus] Length = 615 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +3 Query: 354 MEKVGVLAFMAALIFLLSRAK----CNAEEALLESDKQALLDFANNLSHSRSLNWNENLP 521 MEK L F+A ++ LLS+ AEE LLE+DKQALLDF+ NL HSR LNWN LP Sbjct: 1 MEK---LHFLAGVLLLLSQTHRSSLAGAEETLLETDKQALLDFSYNLRHSRPLNWNSQLP 57