BLASTX nr result
ID: Mentha25_contig00022543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022543 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus... 61 1e-07 >gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus guttatus] Length = 539 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 395 PEGRVHGGNLMAMLAGAPSFNFPRSKPAVDALVTENSFMTHQSWM 261 PEGRVHGGNLMA+LAG P FNFP A + E SF+THQ+WM Sbjct: 496 PEGRVHGGNLMALLAGGPGFNFPSGDMAGPS-EPEKSFVTHQTWM 539