BLASTX nr result
ID: Mentha25_contig00022458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022458 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42719.1| hypothetical protein MIMGU_mgv1a007428mg [Mimulus... 99 6e-19 >gb|EYU42719.1| hypothetical protein MIMGU_mgv1a007428mg [Mimulus guttatus] Length = 408 Score = 99.0 bits (245), Expect = 6e-19 Identities = 52/85 (61%), Positives = 56/85 (65%), Gaps = 2/85 (2%) Frame = -3 Query: 251 HEDXXXXXXXXXXXXXXXXXSVLKYPHDDQGTYSGIGGKVVVSSRHDYHAPYPHDGSEGR 72 HED SVLKYPHDDQGTYS +GGK V SSRHD+H PY G EGR Sbjct: 10 HEDGGNGSGNAGGGGNHSHSSVLKYPHDDQGTYSAVGGKAVGSSRHDFHTPYDM-GQEGR 68 Query: 71 MPKIAPRG--NDAERRSPLLPNMLF 3 +PKIAPR DAERRSP+LPNMLF Sbjct: 69 IPKIAPRNELRDAERRSPMLPNMLF 93