BLASTX nr result
ID: Mentha25_contig00022070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00022070 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40353.1| hypothetical protein MIMGU_mgv1a015725mg [Mimulus... 70 4e-10 gb|EXB51071.1| Ubiquitin-conjugating enzyme E2-17 kDa [Morus not... 69 9e-10 ref|XP_004965488.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 69 9e-10 ref|XP_002438462.1| hypothetical protein SORBIDRAFT_10g020030 [S... 69 9e-10 ref|XP_006444892.1| hypothetical protein CICLE_v10022714mg [Citr... 68 1e-09 gb|EPS68461.1| ubiquitin carrier protein, partial [Genlisea aurea] 68 1e-09 ref|XP_004294879.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 68 1e-09 ref|XP_007206092.1| hypothetical protein PRUPE_ppa012934mg [Prun... 68 1e-09 gb|AFW76708.1| putative ubiquitin-conjugating enzyme family [Zea... 67 2e-09 ref|NP_001131272.1| putative ubiquitin-conjugating enzyme family... 67 2e-09 gb|EYU33745.1| hypothetical protein MIMGU_mgv1a015708mg [Mimulus... 67 3e-09 ref|NP_568788.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis... 67 3e-09 ref|NP_001046486.1| Os02g0261100 [Oryza sativa Japonica Group] g... 67 3e-09 ref|XP_006647135.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 67 3e-09 ref|XP_006346085.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 67 3e-09 ref|XP_006391652.1| hypothetical protein EUTSA_v10023744mg [Eutr... 67 3e-09 ref|XP_006401722.1| hypothetical protein EUTSA_v10014941mg [Eutr... 67 3e-09 ref|XP_007051633.1| Ubiquitin-conjugating enzyme 28 [Theobroma c... 67 3e-09 gb|EMT13517.1| Ubiquitin carrier protein E2 28 [Aegilops tauschii] 67 3e-09 ref|XP_004294717.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 67 3e-09 >gb|EYU40353.1| hypothetical protein MIMGU_mgv1a015725mg [Mimulus guttatus] Length = 148 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTDKVKYEQTARSWT KYAMG Sbjct: 117 DPLVPEIAHMYKTDKVKYEQTARSWTHKYAMG 148 >gb|EXB51071.1| Ubiquitin-conjugating enzyme E2-17 kDa [Morus notabilis] Length = 148 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_004965488.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Setaria italica] Length = 148 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_002438462.1| hypothetical protein SORBIDRAFT_10g020030 [Sorghum bicolor] gi|241916685|gb|EER89829.1| hypothetical protein SORBIDRAFT_10g020030 [Sorghum bicolor] Length = 148 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_006444892.1| hypothetical protein CICLE_v10022714mg [Citrus clementina] gi|568876320|ref|XP_006491229.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1 [Citrus sinensis] gi|557547154|gb|ESR58132.1| hypothetical protein CICLE_v10022714mg [Citrus clementina] Length = 148 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTDK KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDKAKYESTARSWTQKYAMG 148 >gb|EPS68461.1| ubiquitin carrier protein, partial [Genlisea aurea] Length = 82 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD KYEQTARSWTQKYAMG Sbjct: 51 DPLVPEIAHMYKTDSAKYEQTARSWTQKYAMG 82 >ref|XP_004294879.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Fragaria vesca subsp. vesca] Length = 148 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRVKYETTARSWTQKYAMG 148 >ref|XP_007206092.1| hypothetical protein PRUPE_ppa012934mg [Prunus persica] gi|462401734|gb|EMJ07291.1| hypothetical protein PRUPE_ppa012934mg [Prunus persica] Length = 148 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRVKYETTARSWTQKYAMG 148 >gb|AFW76708.1| putative ubiquitin-conjugating enzyme family [Zea mays] Length = 119 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAH+YKTD+VKYE TARSWTQKYAMG Sbjct: 88 DPLVPEIAHLYKTDRVKYESTARSWTQKYAMG 119 >ref|NP_001131272.1| putative ubiquitin-conjugating enzyme family [Zea mays] gi|194691046|gb|ACF79607.1| unknown [Zea mays] gi|413944058|gb|AFW76707.1| putative ubiquitin-conjugating enzyme family [Zea mays] Length = 148 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAH+YKTD+VKYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHLYKTDRVKYESTARSWTQKYAMG 148 >gb|EYU33745.1| hypothetical protein MIMGU_mgv1a015708mg [Mimulus guttatus] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYENTARSWTQKYAMG 148 >ref|NP_568788.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|30696309|ref|NP_851181.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|334188360|ref|NP_001190528.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|297796167|ref|XP_002865968.1| ubiquitin-conjugating enzyme 10 [Arabidopsis lyrata subsp. lyrata] gi|565435358|ref|XP_006281266.1| hypothetical protein CARUB_v10027314mg [Capsella rubella] gi|464987|sp|P35133.1|UBC10_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 10; AltName: Full=Ubiquitin carrier protein 10/12; AltName: Full=Ubiquitin-conjugating enzyme E2-17 kDa 10/12; AltName: Full=Ubiquitin-protein ligase 10/12 gi|11692932|gb|AAG40069.1|AF324718_1 AT5g53300 [Arabidopsis thaliana] gi|11762158|gb|AAG40357.1|AF325005_1 AT5g53300 [Arabidopsis thaliana] gi|11908050|gb|AAG41454.1|AF326872_1 putative E2, ubiquitin-conjugating enzyme UBC10 [Arabidopsis thaliana] gi|297878|emb|CAA78715.1| ubiquitin conjugating enzyme [Arabidopsis thaliana] gi|349213|gb|AAA32895.1| ubiquitin conjugating enzyme [Arabidopsis thaliana] gi|9759177|dbj|BAB09792.1| ubiquitin-conjugating enzyme E2-17 kD 10 (ubiquitin-protein ligase 10) (ubiquitin carrier protein 10) [Arabidopsis thaliana] gi|14517462|gb|AAK62621.1| AT5g53300/K19E1_10 [Arabidopsis thaliana] gi|18086480|gb|AAL57693.1| AT5g53300/K19E1_10 [Arabidopsis thaliana] gi|21280893|gb|AAM44985.1| putative E2, ubiquitin-conjugating enzyme UBC10 [Arabidopsis thaliana] gi|22136576|gb|AAM91074.1| AT5g53300/K19E1_10 [Arabidopsis thaliana] gi|66354428|gb|AAY44850.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|297311803|gb|EFH42227.1| ubiquitin-conjugating enzyme 10 [Arabidopsis lyrata subsp. lyrata] gi|332008951|gb|AED96334.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|332008952|gb|AED96335.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|332008954|gb|AED96337.1| ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] gi|482549970|gb|EOA14164.1| hypothetical protein CARUB_v10027314mg [Capsella rubella] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTDK KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148 >ref|NP_001046486.1| Os02g0261100 [Oryza sativa Japonica Group] gi|75303639|sp|Q8S919.1|UBC5B_ORYSJ RecName: Full=Ubiquitin-conjugating enzyme E2 5B; AltName: Full=Ubiquitin carrier protein 5b; Short=OsUBC5b; AltName: Full=Ubiquitin-protein ligase 5B gi|20152205|dbj|BAB89355.1| ubiquitin-conjugating enzyme OsUBC5b [Oryza sativa Japonica Group] gi|47496965|dbj|BAD20047.1| ubiquitin-conjugating enzyme OsUBC5b [Oryza sativa Japonica Group] gi|113536017|dbj|BAF08400.1| Os02g0261100 [Oryza sativa Japonica Group] gi|125581555|gb|EAZ22486.1| hypothetical protein OsJ_06152 [Oryza sativa Japonica Group] gi|215768166|dbj|BAH00395.1| unnamed protein product [Oryza sativa Japonica Group] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_006647135.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Oryza brachyantha] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_006346085.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Solanum tuberosum] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_006391652.1| hypothetical protein EUTSA_v10023744mg [Eutrema salsugineum] gi|567126812|ref|XP_006391653.1| hypothetical protein EUTSA_v10023744mg [Eutrema salsugineum] gi|557088158|gb|ESQ28938.1| hypothetical protein EUTSA_v10023744mg [Eutrema salsugineum] gi|557088159|gb|ESQ28939.1| hypothetical protein EUTSA_v10023744mg [Eutrema salsugineum] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >ref|XP_006401722.1| hypothetical protein EUTSA_v10014941mg [Eutrema salsugineum] gi|557102812|gb|ESQ43175.1| hypothetical protein EUTSA_v10014941mg [Eutrema salsugineum] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTDK KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148 >ref|XP_007051633.1| Ubiquitin-conjugating enzyme 28 [Theobroma cacao] gi|508703894|gb|EOX95790.1| Ubiquitin-conjugating enzyme 28 [Theobroma cacao] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 >gb|EMT13517.1| Ubiquitin carrier protein E2 28 [Aegilops tauschii] Length = 183 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 152 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 183 >ref|XP_004294717.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Fragaria vesca subsp. vesca] Length = 148 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 359 DPLVPEIAHMYKTDKVKYEQTARSWTQKYAMG 264 DPLVPEIAHMYKTD+ KYE TARSWTQKYAMG Sbjct: 117 DPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148