BLASTX nr result
ID: Mentha25_contig00021772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021772 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI86054.1| enoyl-ACP reductase [Vernicia fordii] 77 3e-12 ref|XP_006435990.1| hypothetical protein CICLE_v10032183mg [Citr... 77 3e-12 gb|ABV60089.1| trans-2-enoyl-CoA reductase [Gossypium hirsutum] 77 3e-12 gb|ABK26395.1| unknown [Picea sitchensis] 77 3e-12 ref|XP_007218716.1| hypothetical protein PRUPE_ppa009010mg [Prun... 76 5e-12 gb|EYU33200.1| hypothetical protein MIMGU_mgv1a010470mg [Mimulus... 75 7e-12 dbj|BAN15750.1| enoyl-CoA reductase [Dianthus caryophyllus] 75 7e-12 ref|XP_002530850.1| Synaptic glycoprotein SC2, putative [Ricinus... 75 7e-12 ref|XP_002316290.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 75 7e-12 ref|XP_006643760.1| PREDICTED: very-long-chain enoyl-CoA reducta... 75 9e-12 ref|XP_007009349.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 75 9e-12 ref|XP_007009348.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 75 9e-12 ref|XP_004307519.1| PREDICTED: very-long-chain enoyl-CoA reducta... 75 9e-12 ref|XP_004142757.1| PREDICTED: very-long-chain enoyl-CoA reducta... 75 9e-12 gb|EPS58785.1| hypothetical protein M569_16028 [Genlisea aurea] 74 2e-11 gb|AGJ00072.1| enoyl-ACP reductase [Malus domestica] 74 2e-11 gb|AGJ00071.1| enoyl-ACP reductase [Malus domestica] 74 2e-11 ref|NP_001265884.1| very-long-chain enoyl-CoA reductase-like [Ci... 74 2e-11 ref|XP_002283594.2| PREDICTED: trans-2,3-enoyl-CoA reductase [Vi... 74 2e-11 ref|NP_001241563.1| uncharacterized protein LOC100785393 [Glycin... 74 2e-11 >gb|AHI86054.1| enoyl-ACP reductase [Vernicia fordii] Length = 310 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_006435990.1| hypothetical protein CICLE_v10032183mg [Citrus clementina] gi|568865474|ref|XP_006486099.1| PREDICTED: very-long-chain enoyl-CoA reductase-like isoform X1 [Citrus sinensis] gi|568865476|ref|XP_006486100.1| PREDICTED: very-long-chain enoyl-CoA reductase-like isoform X2 [Citrus sinensis] gi|557538186|gb|ESR49230.1| hypothetical protein CICLE_v10032183mg [Citrus clementina] Length = 310 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >gb|ABV60089.1| trans-2-enoyl-CoA reductase [Gossypium hirsutum] Length = 310 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >gb|ABK26395.1| unknown [Picea sitchensis] Length = 308 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 276 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 308 >ref|XP_007218716.1| hypothetical protein PRUPE_ppa009010mg [Prunus persica] gi|462415178|gb|EMJ19915.1| hypothetical protein PRUPE_ppa009010mg [Prunus persica] Length = 310 Score = 75.9 bits (185), Expect = 5e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKK+FDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKIFDGKDGRPKYPRRWVILPPFL 310 >gb|EYU33200.1| hypothetical protein MIMGU_mgv1a010470mg [Mimulus guttatus] Length = 311 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRP+YPRRWVILPPFL Sbjct: 279 WALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 311 >dbj|BAN15750.1| enoyl-CoA reductase [Dianthus caryophyllus] Length = 310 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDG+PKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKDGKPKYPRRWVILPPFL 310 >ref|XP_002530850.1| Synaptic glycoprotein SC2, putative [Ricinus communis] gi|223529574|gb|EEF31524.1| Synaptic glycoprotein SC2, putative [Ricinus communis] Length = 310 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRL+KLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLRKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_002316290.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] gi|222865330|gb|EEF02461.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] Length = 310 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGKDGRP+YPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKDGRPRYPRRWVILPPFL 310 >ref|XP_006643760.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Oryza brachyantha] Length = 310 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WAL KHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALGKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_007009349.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 2 [Theobroma cacao] gi|508726262|gb|EOY18159.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 2 [Theobroma cacao] Length = 308 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGK+GRPKYPRRWVILPPFL Sbjct: 276 WALAKHRRLKKLFDGKEGRPKYPRRWVILPPFL 308 >ref|XP_007009348.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 1 [Theobroma cacao] gi|508726261|gb|EOY18158.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 1 [Theobroma cacao] Length = 310 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGK+GRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKEGRPKYPRRWVILPPFL 310 >ref|XP_004307519.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Fragaria vesca subsp. vesca] Length = 310 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WAL KHRRLKKLFDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALGKHRRLKKLFDGKDGRPKYPRRWVILPPFL 310 >ref|XP_004142757.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Cucumis sativus] gi|449483843|ref|XP_004156709.1| PREDICTED: very-long-chain enoyl-CoA reductase-like [Cucumis sativus] Length = 310 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGK+GRPKYPRRWVILPPFL Sbjct: 278 WALAKHRRLKKLFDGKEGRPKYPRRWVILPPFL 310 >gb|EPS58785.1| hypothetical protein M569_16028 [Genlisea aurea] Length = 308 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WA+AKHRRLKKLFDGK+GRPKYPRRWVILPPFL Sbjct: 276 WAMAKHRRLKKLFDGKEGRPKYPRRWVILPPFL 308 >gb|AGJ00072.1| enoyl-ACP reductase [Malus domestica] Length = 310 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WAL KHRRLKK+FDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALTKHRRLKKIFDGKDGRPKYPRRWVILPPFL 310 >gb|AGJ00071.1| enoyl-ACP reductase [Malus domestica] Length = 310 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WAL KHRRLKK+FDGKDGRPKYPRRWVILPPFL Sbjct: 278 WALTKHRRLKKIFDGKDGRPKYPRRWVILPPFL 310 >ref|NP_001265884.1| very-long-chain enoyl-CoA reductase-like [Cicer arietinum] gi|25004880|emb|CAD56504.1| steroid 5-alpha reductase [Cicer arietinum] Length = 309 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGK+GRP+YPRRWVILPPFL Sbjct: 277 WALAKHRRLKKLFDGKEGRPRYPRRWVILPPFL 309 >ref|XP_002283594.2| PREDICTED: trans-2,3-enoyl-CoA reductase [Vitis vinifera] gi|296086235|emb|CBI31676.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRL+KLFDGK+GRPKYPRRWVILPPFL Sbjct: 249 WALAKHRRLRKLFDGKEGRPKYPRRWVILPPFL 281 >ref|NP_001241563.1| uncharacterized protein LOC100785393 [Glycine max] gi|571437941|ref|XP_006574398.1| PREDICTED: uncharacterized protein LOC100785393 isoform X1 [Glycine max] gi|571437943|ref|XP_006574399.1| PREDICTED: uncharacterized protein LOC100785393 isoform X2 [Glycine max] gi|255646198|gb|ACU23584.1| unknown [Glycine max] Length = 309 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 349 WALAKHRRLKKLFDGKDGRPKYPRRWVILPPFL 251 WALAKHRRLKKLFDGK+GRP+YPRRWVILPPFL Sbjct: 277 WALAKHRRLKKLFDGKEGRPRYPRRWVILPPFL 309