BLASTX nr result
ID: Mentha25_contig00021749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021749 (651 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192761.1| uncharacterized protein [Arabidopsis thaliana] ... 56 9e-06 >ref|NP_192761.1| uncharacterized protein [Arabidopsis thaliana] gi|3695409|gb|AAC62809.1| T9A4.8 gene product [Arabidopsis thaliana] gi|4538952|emb|CAB39776.1| hypothetical protein [Arabidopsis thaliana] gi|7267719|emb|CAB78146.1| hypothetical protein [Arabidopsis thaliana] gi|332657457|gb|AEE82857.1| uncharacterized protein AT4G10230 [Arabidopsis thaliana] Length = 273 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 4/98 (4%) Frame = +1 Query: 223 RPEGVKKNKGKRKQEPSHFAKNLFDSYDKLREVLSTSAESRD----RKLKLSETIRDDNI 390 RP G+KK KRKQ+ K L + DKL + ++ R+ +K++++ ++ I Sbjct: 119 RPMGLKK--AKRKQQSEEQFKQLLEQNDKLIKAITKGTSERNEIQRQKIEVARMKEENKI 176 Query: 391 LMLDLNTILDPEKREYFQWEQHQILQKRRNAQQGDTCG 504 L DLN+I DP R Y + E+ +IL+KR Q + G Sbjct: 177 LFADLNSISDPSSRAYVENERKRILEKRAQTNQHEEDG 214