BLASTX nr result
ID: Mentha25_contig00021277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021277 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46765.1| hypothetical protein MIMGU_mgv1a007648mg [Mimulus... 58 2e-06 >gb|EYU46765.1| hypothetical protein MIMGU_mgv1a007648mg [Mimulus guttatus] Length = 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 2 IAVYTCEGSCEGGTSYKEEFAWVQLANQSISH 97 I VYTCE SCE YKEEFAWVQLA+QSISH Sbjct: 369 IVVYTCESSCEASVGYKEEFAWVQLASQSISH 400