BLASTX nr result
ID: Mentha25_contig00021158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00021158 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus... 69 5e-10 >gb|EYU33386.1| hypothetical protein MIMGU_mgv1a005762mg [Mimulus guttatus] Length = 471 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 4/51 (7%) Frame = +3 Query: 3 PSFFLGTAEP---HHQFLPGFDSRG-FQLCYGDAAHANNGRNSAQRGKGKN 143 PSFF+ TA P HHQFL G+D+ G QLCYGDA HANNGR+S Q+GKGKN Sbjct: 422 PSFFVSTAAPVENHHQFLSGYDAAGRLQLCYGDA-HANNGRHSGQKGKGKN 471