BLASTX nr result
ID: Mentha25_contig00020379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020379 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25237.1| hypothetical protein MIMGU_mgv1a010595mg [Mimulus... 82 8e-14 >gb|EYU25237.1| hypothetical protein MIMGU_mgv1a010595mg [Mimulus guttatus] Length = 307 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/47 (76%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -3 Query: 319 TNYQAQRSPNPKDSSRGPGKWMCSPESSSEDRALSTGA-HGWRHTYG 182 +NYQAQRSPNPK++ RG GKWMCSPESS EDRAL+ GA HGWRH +G Sbjct: 261 SNYQAQRSPNPKENIRGLGKWMCSPESSGEDRALANGAHHGWRHNFG 307