BLASTX nr result
ID: Mentha25_contig00020325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020325 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442323.1| hypothetical protein CICLE_v10019362mg [Citr... 61 2e-07 ref|XP_006477803.1| PREDICTED: mitogen-activated protein kinase ... 59 5e-07 >ref|XP_006442323.1| hypothetical protein CICLE_v10019362mg [Citrus clementina] gi|557544585|gb|ESR55563.1| hypothetical protein CICLE_v10019362mg [Citrus clementina] Length = 608 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 8/65 (12%) Frame = -1 Query: 318 ASKPANAMNAERNSNPYLQLS--------RGGIDVKLLQAQSQFATAAVAVASHRDVGAM 163 A+KPA+ + + N NPY Q R ID KLLQAQSQF AAVAVA+HR+VG + Sbjct: 544 AAKPAHGLPVDVNMNPYYQPQAKVDQLNERIAIDAKLLQAQSQFGAAAVAVAAHRNVGTV 603 Query: 162 QLGLT 148 Q GL+ Sbjct: 604 QYGLS 608 >ref|XP_006477803.1| PREDICTED: mitogen-activated protein kinase 19-like [Citrus sinensis] Length = 607 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 8/65 (12%) Frame = -1 Query: 318 ASKPANAMNAERNSNPYLQLS--------RGGIDVKLLQAQSQFATAAVAVASHRDVGAM 163 A+KP + + + N NPY Q R ID KLLQAQSQF AAVAVA+HR+VG + Sbjct: 543 AAKPTHGLPVDVNMNPYYQPQAKVDQLNERIAIDAKLLQAQSQFGAAAVAVAAHRNVGTV 602 Query: 162 QLGLT 148 Q GL+ Sbjct: 603 QYGLS 607