BLASTX nr result
ID: Mentha25_contig00020294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020294 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369511.1| hypothetical protein POPTR_0001s24300g [Popu... 57 3e-06 >ref|XP_006369511.1| hypothetical protein POPTR_0001s24300g [Populus trichocarpa] gi|550348074|gb|ERP66080.1| hypothetical protein POPTR_0001s24300g [Populus trichocarpa] Length = 119 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 23 MAKRVASELFVSRLSFYTTTEELKRLFSPFGVIKEGK 133 MA+R+ +LFVSRLS YTT ELKRLFSPFG + EGK Sbjct: 1 MAQRIGLQLFVSRLSSYTTNHELKRLFSPFGAVSEGK 37