BLASTX nr result
ID: Mentha25_contig00020158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020158 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29447.1| hypothetical protein MIMGU_mgv1a002417mg [Mimulus... 59 5e-07 >gb|EYU29447.1| hypothetical protein MIMGU_mgv1a002417mg [Mimulus guttatus] Length = 678 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 370 LESPSDIIPEGVQGVKELYNLAPYSSIILEAK 275 LESPSD++PEGV GVKE+YN+APYSSIIL+AK Sbjct: 646 LESPSDLVPEGVPGVKEMYNMAPYSSIILQAK 677