BLASTX nr result
ID: Mentha25_contig00020155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00020155 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26952.1| hypothetical protein MIMGU_mgv1a007892mg [Mimulus... 65 8e-09 >gb|EYU26952.1| hypothetical protein MIMGU_mgv1a007892mg [Mimulus guttatus] Length = 392 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -1 Query: 167 MSVARTIFLQCPSIPHFPNSSTSPTPAAVKFTVSCCSLASPAALVNGNVERK 12 MSV RT FL PS PH SS+ +VKFTVSCCS+ASP +VNGNV++K Sbjct: 1 MSVIRTTFLHSPSFPHSSASSSPTNSISVKFTVSCCSVASPITVVNGNVDKK 52