BLASTX nr result
ID: Mentha25_contig00019850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019850 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838258.1| hypothetical protein AMTR_s00103p00060940 [A... 57 4e-06 ref|XP_002513415.1| Proteasome-activating nucleotidase, putative... 57 4e-06 ref|XP_002317020.2| hypothetical protein POPTR_0011s14650g [Popu... 56 5e-06 ref|XP_002274077.1| PREDICTED: ATPase family AAA domain-containi... 56 5e-06 emb|CAN78021.1| hypothetical protein VITISV_015517 [Vitis vinifera] 56 5e-06 ref|XP_002300548.1| AAA-type ATPase family protein [Populus tric... 55 8e-06 >ref|XP_006838258.1| hypothetical protein AMTR_s00103p00060940 [Amborella trichopoda] gi|548840726|gb|ERN00827.1| hypothetical protein AMTR_s00103p00060940 [Amborella trichopoda] Length = 386 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAANGEEV 105 SK CVLD +LFREVVDYKVAEH QRKKLA+ G V Sbjct: 352 SKECVLDASLFREVVDYKVAEHQQRKKLASEGGAV 386 >ref|XP_002513415.1| Proteasome-activating nucleotidase, putative [Ricinus communis] gi|223547323|gb|EEF48818.1| Proteasome-activating nucleotidase, putative [Ricinus communis] Length = 685 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAANGE 99 S+NCVLDT+LFREVVDYKVAEH QR KLA+ E Sbjct: 626 SQNCVLDTSLFREVVDYKVAEHQQRSKLASKSE 658 >ref|XP_002317020.2| hypothetical protein POPTR_0011s14650g [Populus trichocarpa] gi|550328403|gb|EEE97632.2| hypothetical protein POPTR_0011s14650g [Populus trichocarpa] Length = 608 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAANGEE 102 S NCVLD TLFREVVDYKVAEH QR KLA+ E+ Sbjct: 572 SPNCVLDATLFREVVDYKVAEHQQRSKLASKSEQ 605 >ref|XP_002274077.1| PREDICTED: ATPase family AAA domain-containing protein 3-B [Vitis vinifera] gi|297737323|emb|CBI26524.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAAN 93 S+NCVLD+ LFREVVDYKVAEH QRKKLAA+ Sbjct: 596 SENCVLDSNLFREVVDYKVAEHQQRKKLAAS 626 >emb|CAN78021.1| hypothetical protein VITISV_015517 [Vitis vinifera] Length = 626 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAAN 93 S+NCVLD+ LFREVVDYKVAEH QRKKLAA+ Sbjct: 591 SENCVLDSNLFREVVDYKVAEHQQRKKLAAS 621 >ref|XP_002300548.1| AAA-type ATPase family protein [Populus trichocarpa] gi|222847806|gb|EEE85353.1| AAA-type ATPase family protein [Populus trichocarpa] Length = 651 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 SKNCVLDTTLFREVVDYKVAEHYQRKKLAANGEE 102 S+NCVLD+ LFREVVDYKVAEH QR KLA+ +E Sbjct: 615 SQNCVLDSALFREVVDYKVAEHQQRSKLASKSDE 648