BLASTX nr result
ID: Mentha25_contig00019630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019630 (802 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43670.1| hypothetical protein MIMGU_mgv1a022389mg [Mimulus... 60 1e-06 >gb|EYU43670.1| hypothetical protein MIMGU_mgv1a022389mg [Mimulus guttatus] Length = 563 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 671 LHRAALKGEWAAAQHLLKNRSSLITTPITEGGEIALHVAAVEGH 802 LH+AALKG+W AA+ LL SL+ +TEGGE ALH++AVEGH Sbjct: 11 LHKAALKGDWEAAKELLIKDPSLVKDSLTEGGETALHISAVEGH 54