BLASTX nr result
ID: Mentha25_contig00019249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019249 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24046.1| hypothetical protein MIMGU_mgv1a016967mg [Mimulus... 61 1e-07 ref|XP_007206181.1| hypothetical protein PRUPE_ppa013840mg [Prun... 57 4e-06 >gb|EYU24046.1| hypothetical protein MIMGU_mgv1a016967mg [Mimulus guttatus] Length = 99 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -1 Query: 328 IPSTTRDVNVPHNDHHD-YHQNSSPTARRSIFRYFNCCVKA 209 IPST R N+P ND H+ +H++ SPT RRS FRYFNCCVKA Sbjct: 59 IPSTKRVSNIPQNDTHEVFHESHSPTGRRSFFRYFNCCVKA 99 >ref|XP_007206181.1| hypothetical protein PRUPE_ppa013840mg [Prunus persica] gi|462401823|gb|EMJ07380.1| hypothetical protein PRUPE_ppa013840mg [Prunus persica] Length = 100 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = -1 Query: 328 IPSTTRDVNVPHNDHHD-YHQ-NSSPTARRSIFRYFNCCVKA 209 I + T +V PHNDHH YHQ + SPT RRSIF YFNCCV+A Sbjct: 59 IATNTANVEPPHNDHHPHYHQRHHSPTTRRSIFSYFNCCVRA 100