BLASTX nr result
ID: Mentha25_contig00019077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00019077 (730 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011149.1| F-box and associated interaction domains-con... 64 4e-08 ref|XP_007011148.1| F-box and associated interaction domains-con... 64 4e-08 ref|XP_007011147.1| F-box and associated interaction domains-con... 64 4e-08 ref|XP_007011146.1| F-box and associated interaction domains-con... 64 4e-08 ref|XP_007011145.1| F-box and associated interaction domains-con... 64 4e-08 ref|XP_007015750.1| F-box and associated interaction domains-con... 62 3e-07 ref|XP_003546182.1| PREDICTED: F-box protein CPR30-like isoform ... 62 3e-07 ref|XP_007011137.1| F-box and associated interaction domains-con... 60 1e-06 ref|XP_003534732.1| PREDICTED: F-box protein CPR30-like isoform ... 60 1e-06 ref|XP_003637494.1| F-box protein [Medicago truncatula] gi|35550... 60 1e-06 ref|XP_007011152.1| F-box and associated interaction domains-con... 59 1e-06 ref|XP_007011143.1| F-box and associated interaction domains-con... 59 1e-06 ref|XP_007207968.1| hypothetical protein PRUPE_ppa016317mg [Prun... 57 5e-06 >ref|XP_007011149.1| F-box and associated interaction domains-containing protein isoform 3 [Theobroma cacao] gi|508728062|gb|EOY19959.1| F-box and associated interaction domains-containing protein isoform 3 [Theobroma cacao] Length = 400 Score = 64.3 bits (155), Expect = 4e-08 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +3 Query: 366 MATEETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKA 545 + +E +F+ + G C GL+C+ + + ++WNPST EVK LP+S I RP Sbjct: 89 LKVKENIHMLDFDQLTVSGPCNGLLCVHD-NYSIILWNPSTREVKVLPESTISRP----- 142 Query: 546 LPLTITTFSLASGFGFDYKSHDYKFLRWV 632 P T T+ GFGFD S+DYK LR V Sbjct: 143 -PATDDTYFGFVGFGFDRNSNDYKVLRCV 170 >ref|XP_007011148.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] gi|508728061|gb|EOY19958.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] Length = 379 Score = 64.3 bits (155), Expect = 4e-08 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +3 Query: 366 MATEETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKA 545 + +E +F+ + G C GL+C+ + + ++WNPST EVK LP+S I RP Sbjct: 89 LKVKENIHMLDFDQLTVSGPCNGLLCVHD-NYSIILWNPSTREVKVLPESTISRP----- 142 Query: 546 LPLTITTFSLASGFGFDYKSHDYKFLRWV 632 P T T+ GFGFD S+DYK LR V Sbjct: 143 -PATDDTYFGFVGFGFDRNSNDYKVLRCV 170 >ref|XP_007011147.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] gi|508728060|gb|EOY19957.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] Length = 467 Score = 64.3 bits (155), Expect = 4e-08 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +3 Query: 366 MATEETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKA 545 + +E +F+ + G C GL+C+ + + ++WNPST EVK LP+S I RP Sbjct: 89 LKVKENIHMLDFDQLTVSGPCNGLLCVHD-NYSIILWNPSTREVKVLPESTISRP----- 142 Query: 546 LPLTITTFSLASGFGFDYKSHDYKFLRWV 632 P T T+ GFGFD S+DYK LR V Sbjct: 143 -PATDDTYFGFVGFGFDRNSNDYKVLRCV 170 >ref|XP_007011146.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] gi|508728059|gb|EOY19956.1| F-box and associated interaction domains-containing protein isoform 2 [Theobroma cacao] Length = 400 Score = 64.3 bits (155), Expect = 4e-08 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +3 Query: 366 MATEETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKA 545 + +E +F+ + G C GL+C+ + + ++WNPST EVK LP+S I RP Sbjct: 89 LKVKENIHMLDFDQLTVSGPCNGLLCVHD-NYSIILWNPSTREVKVLPESTISRP----- 142 Query: 546 LPLTITTFSLASGFGFDYKSHDYKFLRWV 632 P T T+ GFGFD S+DYK LR V Sbjct: 143 -PATDDTYFGFVGFGFDRNSNDYKVLRCV 170 >ref|XP_007011145.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] gi|508728058|gb|EOY19955.1| F-box and associated interaction domains-containing protein isoform 1 [Theobroma cacao] Length = 467 Score = 64.3 bits (155), Expect = 4e-08 Identities = 36/89 (40%), Positives = 50/89 (56%) Frame = +3 Query: 366 MATEETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKA 545 + +E +F+ + G C GL+C+ + + ++WNPST EVK LP+S I RP Sbjct: 89 LKVKENIHMLDFDQLTVSGPCNGLLCVHD-NYSIILWNPSTREVKVLPESTISRP----- 142 Query: 546 LPLTITTFSLASGFGFDYKSHDYKFLRWV 632 P T T+ GFGFD S+DYK LR V Sbjct: 143 -PATDDTYFGFVGFGFDRNSNDYKVLRCV 170 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 61.6 bits (148), Expect = 3e-07 Identities = 46/115 (40%), Positives = 58/115 (50%), Gaps = 7/115 (6%) Frame = +3 Query: 321 YYFSPLSPD---NFSPMAMATEETSKFPNFNG--YNLV--GSCRGLVCLGNRDEEAVIWN 479 +YFS LS + NFS E P F Y V G C GL+CL + + A +WN Sbjct: 75 HYFSALSTEKGENFS-----VTENIHLPFFENCWYAPVVSGPCNGLLCLHDAGK-AALWN 128 Query: 480 PSTNEVKYLPKSDIPRPDPAKALPLTITTFSLASGFGFDYKSHDYKFLRWVCFYF 644 PST E K LP+S + RP P +T GFGFD + DYK +R+V YF Sbjct: 129 PSTREFKILPRSSVNRP------PSVDSTSFGCLGFGFDSITDDYKVVRFVTNYF 177 >ref|XP_003546182.1| PREDICTED: F-box protein CPR30-like isoform X1 [Glycine max] Length = 394 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/75 (38%), Positives = 42/75 (56%) Frame = +3 Query: 402 NGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLAS 581 N L+GSC GL+C+ N ++ WNPS + + LP +PR + P T + Sbjct: 89 NSITLLGSCNGLLCISNVADDIAFWNPSLRQHRILPYLPVPR----RRHPDTTLFAARVC 144 Query: 582 GFGFDYKSHDYKFLR 626 GFGFD+K+ DYK +R Sbjct: 145 GFGFDHKTRDYKLVR 159 >ref|XP_007011137.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728050|gb|EOY19947.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 548 Score = 59.7 bits (143), Expect = 1e-06 Identities = 34/76 (44%), Positives = 41/76 (53%) Frame = +3 Query: 414 LVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLASGFGF 593 ++G C GL+CL + +WNPS EVK+LPKS I P P T T GFGF Sbjct: 435 VMGLCNGLLCLHD-SYRITLWNPSMREVKFLPKSTISSP------PSTSHTSFYCIGFGF 487 Query: 594 DYKSHDYKFLRWVCFY 641 D K DYK L +V Y Sbjct: 488 DRKLDDYKILVYVFHY 503 Score = 57.0 bits (136), Expect = 6e-06 Identities = 41/122 (33%), Positives = 55/122 (45%), Gaps = 14/122 (11%) Frame = +3 Query: 300 YYGGTGAYYFSPLSPDNFSP--------MAMATEETSKFP------NFNGYNLVGSCRGL 437 ++GG +FS LS + S + +E + P N + + G C GL Sbjct: 62 FFGGFKVPHFSLLSTETESKKHGGPNVEFNLQIKENIRMPVPICSGNRSRLTVSGVCNGL 121 Query: 438 VCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLASGFGFDYKSHDYK 617 +CL + +WNPST EVK LP+S I P P T+ G GFD KS DYK Sbjct: 122 LCLHD-GYRITLWNPSTREVKLLPESTISLP------PFVDCTYFYCMGLGFDRKSDDYK 174 Query: 618 FL 623 L Sbjct: 175 VL 176 >ref|XP_003534732.1| PREDICTED: F-box protein CPR30-like isoform X1 [Glycine max] Length = 392 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/75 (38%), Positives = 41/75 (54%) Frame = +3 Query: 402 NGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLAS 581 N L+GSC GL+C+ N ++ WNPS + + LP +PR + P T + Sbjct: 89 NNITLLGSCNGLLCISNVADDIAFWNPSLRQHRILPSLPLPR---RRLHPDTTLFAARVY 145 Query: 582 GFGFDYKSHDYKFLR 626 GFGFD+ S DYK +R Sbjct: 146 GFGFDHTSPDYKLVR 160 >ref|XP_003637494.1| F-box protein [Medicago truncatula] gi|355503429|gb|AES84632.1| F-box protein [Medicago truncatula] Length = 381 Score = 59.7 bits (143), Expect = 1e-06 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Frame = +3 Query: 345 DNFSPMAMATEETSKFPNFNGY-NLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDI 521 ++FS + A + F N + +LVGSC GL+CL + D E WNP+ + + +P + Sbjct: 65 NDFSNLTTAVKLNPPFKGSNNFISLVGSCNGLLCLFS-DGEIAFWNPTICKHRIIPS--L 121 Query: 522 PRPDPAKALPLTITTFSLASGFGFDYKSHDYKFLRWVCF 638 P P P + P I GFGFD + DYK L CF Sbjct: 122 PIPTPQHSEPNNIYADFCVYGFGFDPLTDDYKLLTIFCF 160 >ref|XP_007011152.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728065|gb|EOY19962.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 686 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/77 (45%), Positives = 41/77 (53%) Frame = +3 Query: 414 LVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLASGFGF 593 + G C GL+CL + +WNPST EVK +PKS I RP A T+ GFGF Sbjct: 524 MFGPCNGLLCLDDGCG-ITLWNPSTREVKVVPKSSISRPASA------YCTYFSCIGFGF 576 Query: 594 DYKSHDYKFLRWVCFYF 644 D KS DYK L V F Sbjct: 577 DSKSDDYKILDKVTHRF 593 >ref|XP_007011143.1| F-box and associated interaction domains-containing protein [Theobroma cacao] gi|508728056|gb|EOY19953.1| F-box and associated interaction domains-containing protein [Theobroma cacao] Length = 271 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/77 (45%), Positives = 41/77 (53%) Frame = +3 Query: 414 LVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLTITTFSLASGFGF 593 + G C GL+CL + +WNPST EVK +PKS I RP A T+ GFGF Sbjct: 109 MFGPCNGLLCLDDGCG-ITLWNPSTREVKVVPKSSISRPASA------YCTYFSCIGFGF 161 Query: 594 DYKSHDYKFLRWVCFYF 644 D KS DYK L V F Sbjct: 162 DSKSDDYKILDKVTHRF 178 >ref|XP_007207968.1| hypothetical protein PRUPE_ppa016317mg [Prunus persica] gi|462403610|gb|EMJ09167.1| hypothetical protein PRUPE_ppa016317mg [Prunus persica] Length = 408 Score = 57.4 bits (137), Expect = 5e-06 Identities = 31/86 (36%), Positives = 44/86 (51%) Frame = +3 Query: 378 ETSKFPNFNGYNLVGSCRGLVCLGNRDEEAVIWNPSTNEVKYLPKSDIPRPDPAKALPLT 557 + S F +++G C G+VCL +R + V+ NP+ E+K LPKS +P+ Sbjct: 106 QRSGFEVIESLSMIGQCDGIVCLCDRRDNIVLCNPAIKELKLLPKSCLPQ---------- 155 Query: 558 ITTFSLASGFGFDYKSHDYKFLRWVC 635 A GFG+D KS DYK R C Sbjct: 156 --LIQCAVGFGYDPKSKDYKIHRISC 179