BLASTX nr result
ID: Mentha25_contig00018821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018821 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589662.1| Pentatricopeptide repeat-containing protein ... 57 3e-06 >ref|XP_003589662.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478710|gb|AES59913.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 988 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = +3 Query: 351 TYLVKGRYDDALKLFDEMQARHVAPNIMTYNILLHGLCRAHRMD 482 +Y V+GR D A K FDEMQ + V+PN++TYN L++GLC+ + MD Sbjct: 566 SYAVRGRLDFAKKYFDEMQDKGVSPNVITYNALIYGLCKENMMD 609