BLASTX nr result
ID: Mentha25_contig00018769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00018769 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154346.1| hypothetical protein PHAVU_003G111000g [Phas... 103 2e-20 ref|XP_006584010.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 102 6e-20 ref|XP_003550553.1| PREDICTED: AMSH-like ubiquitin thiolesterase... 102 6e-20 ref|XP_006488873.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 101 9e-20 ref|XP_006419435.1| hypothetical protein CICLE_v10004794mg [Citr... 101 9e-20 ref|XP_004508167.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 100 2e-19 gb|EYU44002.1| hypothetical protein MIMGU_mgv1a004833mg [Mimulus... 100 4e-19 ref|XP_007035736.1| Associated molecule with the SH3 domain of S... 99 6e-19 emb|CBI22917.3| unnamed protein product [Vitis vinifera] 99 6e-19 gb|AFK36420.1| unknown [Medicago truncatula] 99 8e-19 ref|XP_003609726.1| STAM-binding protein [Medicago truncatula] g... 99 8e-19 ref|XP_006355400.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 98 1e-18 ref|XP_004228996.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 98 1e-18 ref|XP_006414386.1| hypothetical protein EUTSA_v10025009mg [Eutr... 97 2e-18 ref|XP_006285277.1| hypothetical protein CARUB_v10006653mg, part... 97 2e-18 ref|XP_002868158.1| At4g16144 [Arabidopsis lyrata subsp. lyrata]... 97 2e-18 ref|NP_680708.6| AMSH-like ubiquitin thiolesterase 3 [Arabidopsi... 97 2e-18 gb|AAV85709.1| At4g16144 [Arabidopsis thaliana] 97 2e-18 ref|XP_002316018.2| hypothetical protein POPTR_0010s15100g [Popu... 97 2e-18 gb|EPS59442.1| hypothetical protein M569_15365, partial [Genlise... 95 1e-17 >ref|XP_007154346.1| hypothetical protein PHAVU_003G111000g [Phaseolus vulgaris] gi|561027700|gb|ESW26340.1| hypothetical protein PHAVU_003G111000g [Phaseolus vulgaris] Length = 512 Score = 103 bits (257), Expect = 2e-20 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEES DGSPIYEHCSHVYMNA LKFDVVDLR Sbjct: 463 PGGVSVIRNCQQRGFHPHEESSDGSPIYEHCSHVYMNANLKFDVVDLR 510 >ref|XP_006584010.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Glycine max] Length = 504 Score = 102 bits (254), Expect = 6e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEE EDG+PIYEHCSHVYMNA LKFDVVDLR Sbjct: 455 PGGVSVIRNCQQRGFHPHEEPEDGTPIYEHCSHVYMNANLKFDVVDLR 502 >ref|XP_003550553.1| PREDICTED: AMSH-like ubiquitin thiolesterase 3-like [Glycine max] Length = 504 Score = 102 bits (254), Expect = 6e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEE EDG+PIYEHCSHVYMNA LKFDVVDLR Sbjct: 455 PGGVSVIRNCQQRGFHPHEEPEDGTPIYEHCSHVYMNANLKFDVVDLR 502 >ref|XP_006488873.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Citrus sinensis] Length = 506 Score = 101 bits (252), Expect = 9e-20 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEE EDGSP+YEHCSHV+MNAKL+FDVVDLR Sbjct: 459 PGGVSVIRNCQQRGFHPHEEPEDGSPLYEHCSHVFMNAKLQFDVVDLR 506 >ref|XP_006419435.1| hypothetical protein CICLE_v10004794mg [Citrus clementina] gi|557521308|gb|ESR32675.1| hypothetical protein CICLE_v10004794mg [Citrus clementina] Length = 506 Score = 101 bits (252), Expect = 9e-20 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEE EDGSP+YEHCSHV+MNAKL+FDVVDLR Sbjct: 459 PGGVSVIRNCQQRGFHPHEEPEDGSPLYEHCSHVFMNAKLQFDVVDLR 506 >ref|XP_004508167.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Cicer arietinum] Length = 506 Score = 100 bits (249), Expect = 2e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQQRGFHPHEE DGSPIYEHCSHVYMNA +KFDV+DLR Sbjct: 457 PGGVSVIRNCQQRGFHPHEEPSDGSPIYEHCSHVYMNANMKFDVIDLR 504 >gb|EYU44002.1| hypothetical protein MIMGU_mgv1a004833mg [Mimulus guttatus] Length = 508 Score = 99.8 bits (247), Expect = 4e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIR+CQQRGFHPHEE EDG+PIYEHCSHVYMNA +KFDVVDLR Sbjct: 461 PGGVSVIRHCQQRGFHPHEEPEDGTPIYEHCSHVYMNANIKFDVVDLR 508 >ref|XP_007035736.1| Associated molecule with the SH3 domain of STAM 3 isoform 1 [Theobroma cacao] gi|590661667|ref|XP_007035737.1| Associated molecule with the SH3 domain of STAM 3 isoform 1 [Theobroma cacao] gi|508714765|gb|EOY06662.1| Associated molecule with the SH3 domain of STAM 3 isoform 1 [Theobroma cacao] gi|508714766|gb|EOY06663.1| Associated molecule with the SH3 domain of STAM 3 isoform 1 [Theobroma cacao] Length = 505 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVS+IRNCQQRGFHPHEE DGSPIYEHCSHV+MN K+KFDVVDLR Sbjct: 458 PGGVSIIRNCQQRGFHPHEEPSDGSPIYEHCSHVFMNPKIKFDVVDLR 505 >emb|CBI22917.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEE DGSPIYEHCSHVYMN KLKFDVVDLR Sbjct: 469 PAGVSVIRNCQQRGFHPHEECPDGSPIYEHCSHVYMNPKLKFDVVDLR 516 >gb|AFK36420.1| unknown [Medicago truncatula] Length = 261 Score = 98.6 bits (244), Expect = 8e-19 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQ+RGFHPHEE DGSPIYEHCSHVYMNA +KFDV+DLR Sbjct: 212 PGGVSVIRNCQERGFHPHEEPSDGSPIYEHCSHVYMNANMKFDVLDLR 259 >ref|XP_003609726.1| STAM-binding protein [Medicago truncatula] gi|355510781|gb|AES91923.1| STAM-binding protein [Medicago truncatula] Length = 509 Score = 98.6 bits (244), Expect = 8e-19 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGVSVIRNCQ+RGFHPHEE DGSPIYEHCSHVYMNA +KFDV+DLR Sbjct: 460 PGGVSVIRNCQERGFHPHEEPSDGSPIYEHCSHVYMNANMKFDVLDLR 507 >ref|XP_006355400.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Solanum tuberosum] Length = 515 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIR CQQRGFHPHEE EDGSPIYEHCSHVYMNA +KFD+VDLR Sbjct: 468 PAGVSVIRKCQQRGFHPHEEPEDGSPIYEHCSHVYMNANMKFDIVDLR 515 >ref|XP_004228996.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Solanum lycopersicum] Length = 515 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIR CQQRGFHPHEE EDGSPIYEHCSHVYMNA +KFD+VDLR Sbjct: 468 PAGVSVIRKCQQRGFHPHEEPEDGSPIYEHCSHVYMNANMKFDIVDLR 515 >ref|XP_006414386.1| hypothetical protein EUTSA_v10025009mg [Eutrema salsugineum] gi|557115556|gb|ESQ55839.1| hypothetical protein EUTSA_v10025009mg [Eutrema salsugineum] Length = 493 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEESEDG+PIYEHCSHV++NAKLK++V+DLR Sbjct: 446 PSGVSVIRNCQQRGFHPHEESEDGNPIYEHCSHVFLNAKLKYEVLDLR 493 >ref|XP_006285277.1| hypothetical protein CARUB_v10006653mg, partial [Capsella rubella] gi|482553982|gb|EOA18175.1| hypothetical protein CARUB_v10006653mg, partial [Capsella rubella] Length = 426 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEESEDG+PIYEHCSHV++NAKLK++V+DLR Sbjct: 379 PSGVSVIRNCQQRGFHPHEESEDGNPIYEHCSHVFLNAKLKYEVLDLR 426 >ref|XP_002868158.1| At4g16144 [Arabidopsis lyrata subsp. lyrata] gi|297313994|gb|EFH44417.1| At4g16144 [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEESEDG+PIYEHCSHV++NAKLK++V+DLR Sbjct: 460 PSGVSVIRNCQQRGFHPHEESEDGNPIYEHCSHVFLNAKLKYEVLDLR 507 >ref|NP_680708.6| AMSH-like ubiquitin thiolesterase 3 [Arabidopsis thaliana] gi|302595939|sp|Q5PNU3.2|AMSH3_ARATH RecName: Full=AMSH-like ubiquitin thioesterase 3; AltName: Full=Deubiquitinating enzyme AMSH3 gi|332658301|gb|AEE83701.1| AMSH-like ubiquitin thiolesterase 3 [Arabidopsis thaliana] Length = 507 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEESEDG+PIYEHCSHV++NAKLK++V+DLR Sbjct: 460 PSGVSVIRNCQQRGFHPHEESEDGNPIYEHCSHVFLNAKLKYEVLDLR 507 >gb|AAV85709.1| At4g16144 [Arabidopsis thaliana] Length = 507 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEESEDG+PIYEHCSHV++NAKLK++V+DLR Sbjct: 460 PSGVSVIRNCQQRGFHPHEESEDGNPIYEHCSHVFLNAKLKYEVLDLR 507 >ref|XP_002316018.2| hypothetical protein POPTR_0010s15100g [Populus trichocarpa] gi|550329851|gb|EEF02189.2| hypothetical protein POPTR_0010s15100g [Populus trichocarpa] Length = 503 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 P GVSVIRNCQQRGFHPHEES DGSPIYEHCSHVYMN+ +KFDVVDLR Sbjct: 456 PSGVSVIRNCQQRGFHPHEESLDGSPIYEHCSHVYMNSIMKFDVVDLR 503 >gb|EPS59442.1| hypothetical protein M569_15365, partial [Genlisea aurea] Length = 142 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = -1 Query: 334 PGGVSVIRNCQQRGFHPHEESEDGSPIYEHCSHVYMNAKLKFDVVDLR 191 PGGV VIR C QRGFHPH+E +DGSPIYEHCSHVYMN KLKFDVVDLR Sbjct: 95 PGGVGVIRGCPQRGFHPHKEPDDGSPIYEHCSHVYMNPKLKFDVVDLR 142