BLASTX nr result
ID: Mentha25_contig00017325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017325 (582 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239986.1| PREDICTED: uncharacterized protein LOC101245... 57 3e-06 ref|XP_006355551.1| PREDICTED: branchpoint-bridging protein-like... 56 6e-06 >ref|XP_004239986.1| PREDICTED: uncharacterized protein LOC101245847 [Solanum lycopersicum] Length = 282 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +1 Query: 4 SSGETQH-YPPGVQSQSSAPVQSGPTYAYGNSVTAM 108 SSGETQ YPPGVQS +SAPVQS P+YAYGNSV AM Sbjct: 164 SSGETQQSYPPGVQSHNSAPVQSLPSYAYGNSVAAM 199 >ref|XP_006355551.1| PREDICTED: branchpoint-bridging protein-like isoform X1 [Solanum tuberosum] Length = 814 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +1 Query: 4 SSGETQH-YPPGVQSQSSAPVQSGPTYAYGNSVTAM 108 SSGETQ YPPGVQS +SAPVQS P+YAYGNSV A+ Sbjct: 694 SSGETQQSYPPGVQSHNSAPVQSLPSYAYGNSVAAL 729