BLASTX nr result
ID: Mentha25_contig00017245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017245 (638 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76115.1| sucrose transporter [Blumeria graminis f. sp. ho... 61 3e-07 >emb|CCU76115.1| sucrose transporter [Blumeria graminis f. sp. hordei DH14] Length = 635 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 168 LVSTTYLPAKTNSSPSRGAGVNAQYALHI*DSQEESRPNQNQ 293 LV T PAKTNSSPS GAGV AQYALHI DSQEES PN+++ Sbjct: 594 LVYTLIQPAKTNSSPSSGAGVIAQYALHIWDSQEESHPNRSR 635