BLASTX nr result
ID: Mentha25_contig00017126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017126 (878 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29336.1| hypothetical protein MIMGU_mgv1a022418mg [Mimulus... 69 3e-09 >gb|EYU29336.1| hypothetical protein MIMGU_mgv1a022418mg [Mimulus guttatus] Length = 873 Score = 68.6 bits (166), Expect = 3e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 15 RKAKPEDVLWSISVPTEGEAATWDERIALSVHVRNPDIVF 134 RKA EDVLWSIS P EGEA WD+R+AL+VH+RNPDI+F Sbjct: 832 RKALSEDVLWSISCPIEGEAVAWDDRVALNVHIRNPDIIF 871