BLASTX nr result
ID: Mentha25_contig00017123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00017123 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20263.1| hypothetical protein MIMGU_mgv1a007003mg [Mimulus... 56 5e-06 >gb|EYU20263.1| hypothetical protein MIMGU_mgv1a007003mg [Mimulus guttatus] Length = 423 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 5/76 (6%) Frame = -3 Query: 340 VKKPVRKSLPKLPSEDLKSSNEKKRPTSLKKVTPKETSDSIT---ASDTQK--HDAETGL 176 VKKP+RKSLPKLPSE+ S EKK+ S K KET +S+ ASD + + +E + Sbjct: 348 VKKPLRKSLPKLPSEEADLSFEKKKSVSRKITATKETGESVVVVQASDLSEEVNKSEEPV 407 Query: 175 SIGREQAALAQEAIAV 128 +E A+L +EAIAV Sbjct: 408 LEVQENASLVREAIAV 423