BLASTX nr result
ID: Mentha25_contig00016311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00016311 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37921.1| hypothetical protein MIMGU_mgv1a007029mg [Mimulus... 84 3e-14 >gb|EYU37921.1| hypothetical protein MIMGU_mgv1a007029mg [Mimulus guttatus] Length = 422 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/60 (68%), Positives = 49/60 (81%), Gaps = 3/60 (5%) Frame = +1 Query: 4 DGPDPAKKNFWSG--RERLQ-EEKTERAWRKPDSAGSRPQSAGESVTGQSEKSENGHAEE 174 D P PAK++FWSG R+R+Q E KTE+AWRKP+S GSRPQSAGES G +E +ENGHAEE Sbjct: 354 DVPVPAKRSFWSGNGRDRVQPEHKTEKAWRKPESVGSRPQSAGESENGTAENTENGHAEE 413