BLASTX nr result
ID: Mentha25_contig00016034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00016034 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21742.1| hypothetical protein MIMGU_mgv1a006408mg [Mimulus... 82 6e-14 emb|CBI25190.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002263392.1| PREDICTED: magnesium transporter MRS2-1-like... 75 1e-11 ref|NP_563988.1| magnesium transporter MRS2-1 [Arabidopsis thali... 74 2e-11 ref|XP_006304371.1| hypothetical protein CARUB_v10010853mg [Caps... 74 2e-11 ref|XP_002892891.1| hypothetical protein ARALYDRAFT_471800 [Arab... 74 2e-11 ref|XP_006416855.1| hypothetical protein EUTSA_v10007638mg [Eutr... 74 2e-11 ref|XP_007023463.1| Magnesium transporter isoform 3 [Theobroma c... 73 5e-11 ref|XP_007023462.1| Magnesium transporter 2 isoform 2 [Theobroma... 73 5e-11 ref|XP_007023461.1| Magnesium transporter isoform 1 [Theobroma c... 73 5e-11 ref|XP_004241677.1| PREDICTED: magnesium transporter MRS2-1-like... 72 6e-11 ref|XP_007150818.1| hypothetical protein PHAVU_005G183100g [Phas... 72 8e-11 ref|XP_006356254.1| PREDICTED: magnesium transporter MRS2-1-like... 72 1e-10 ref|XP_004486600.1| PREDICTED: magnesium transporter MRS2-1-like... 70 2e-10 ref|XP_006493378.1| PREDICTED: magnesium transporter MRS2-1-like... 70 3e-10 ref|XP_006427652.1| hypothetical protein CICLE_v10025612mg [Citr... 70 3e-10 ref|XP_004303233.1| PREDICTED: magnesium transporter MRS2-1-like... 69 5e-10 ref|XP_003543708.1| PREDICTED: magnesium transporter MRS2-1-like... 69 7e-10 ref|XP_004160340.1| PREDICTED: magnesium transporter MRS2-1-like... 69 9e-10 ref|XP_004137654.1| PREDICTED: magnesium transporter MRS2-1-like... 69 9e-10 >gb|EYU21742.1| hypothetical protein MIMGU_mgv1a006408mg [Mimulus guttatus] Length = 445 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MF+NPGAFKWVLIITGVCGAIIF+TFLWFFKYRRLMPL Sbjct: 408 MFDNPGAFKWVLIITGVCGAIIFATFLWFFKYRRLMPL 445 >emb|CBI25190.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MF++PGAFKWVLIITG+CG IIF +F+WFFKYRRLMPL Sbjct: 317 MFDDPGAFKWVLIITGICGIIIFCSFVWFFKYRRLMPL 354 >ref|XP_002263392.1| PREDICTED: magnesium transporter MRS2-1-like [Vitis vinifera] Length = 444 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MF++PGAFKWVLIITG+CG IIF +F+WFFKYRRLMPL Sbjct: 407 MFDDPGAFKWVLIITGICGIIIFCSFVWFFKYRRLMPL 444 >ref|NP_563988.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|145323912|ref|NP_001077545.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|334182607|ref|NP_001185007.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|75199341|sp|Q9S9N4.1|MRS21_ARATH RecName: Full=Magnesium transporter MRS2-1; AltName: Full=Magnesium Transporter 2; Short=AtMGT2 gi|6587806|gb|AAF18497.1|AC010924_10 Contains similarity to gb|M82916 MRS2 protein from Saccharomyces cerivisae. ESTs gb|N96043, gb|AI998651, gb|AA585850, gb|T42027 come from this gene [Arabidopsis thaliana] gi|10880269|emb|CAC13981.1| putative magnesium transporter [Arabidopsis thaliana] gi|15451154|gb|AAK96848.1| Unknown protein [Arabidopsis thaliana] gi|20148403|gb|AAM10092.1| unknown protein [Arabidopsis thaliana] gi|25360797|gb|AAN73211.1| MRS2-1 [Arabidopsis thaliana] gi|227204423|dbj|BAH57063.1| AT1G16010 [Arabidopsis thaliana] gi|227206182|dbj|BAH57146.1| AT1G16010 [Arabidopsis thaliana] gi|332191274|gb|AEE29395.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|332191275|gb|AEE29396.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] gi|332191276|gb|AEE29397.1| magnesium transporter MRS2-1 [Arabidopsis thaliana] Length = 442 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 FN PGAF+WVLIITGVCG +IFS F+WFFKYRRLMPL Sbjct: 406 FNQPGAFRWVLIITGVCGFVIFSAFVWFFKYRRLMPL 442 >ref|XP_006304371.1| hypothetical protein CARUB_v10010853mg [Capsella rubella] gi|482573082|gb|EOA37269.1| hypothetical protein CARUB_v10010853mg [Capsella rubella] Length = 443 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 FN PGAF+WVLIITGVCG +IFS F+WFFKYRRLMPL Sbjct: 407 FNQPGAFRWVLIITGVCGFVIFSAFVWFFKYRRLMPL 443 >ref|XP_002892891.1| hypothetical protein ARALYDRAFT_471800 [Arabidopsis lyrata subsp. lyrata] gi|297338733|gb|EFH69150.1| hypothetical protein ARALYDRAFT_471800 [Arabidopsis lyrata subsp. lyrata] Length = 443 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 FN PGAF+WVLIITGVCG +IFS F+WFFKYRRLMPL Sbjct: 407 FNQPGAFRWVLIITGVCGFVIFSAFVWFFKYRRLMPL 443 >ref|XP_006416855.1| hypothetical protein EUTSA_v10007638mg [Eutrema salsugineum] gi|557094626|gb|ESQ35208.1| hypothetical protein EUTSA_v10007638mg [Eutrema salsugineum] Length = 444 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 FN PGAF+WVLIITG+CG +IFS F+WFFKYRRLMPL Sbjct: 408 FNQPGAFRWVLIITGICGFVIFSAFVWFFKYRRLMPL 444 >ref|XP_007023463.1| Magnesium transporter isoform 3 [Theobroma cacao] gi|508778829|gb|EOY26085.1| Magnesium transporter isoform 3 [Theobroma cacao] Length = 405 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +F++PGAFKWVLI+TG+CG IIF F+WFFKYRRLMPL Sbjct: 368 LFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 405 >ref|XP_007023462.1| Magnesium transporter 2 isoform 2 [Theobroma cacao] gi|508778828|gb|EOY26084.1| Magnesium transporter 2 isoform 2 [Theobroma cacao] Length = 331 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +F++PGAFKWVLI+TG+CG IIF F+WFFKYRRLMPL Sbjct: 294 LFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 331 >ref|XP_007023461.1| Magnesium transporter isoform 1 [Theobroma cacao] gi|508778827|gb|EOY26083.1| Magnesium transporter isoform 1 [Theobroma cacao] Length = 442 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +F++PGAFKWVLI+TG+CG IIF F+WFFKYRRLMPL Sbjct: 405 LFDDPGAFKWVLIVTGICGIIIFCAFVWFFKYRRLMPL 442 >ref|XP_004241677.1| PREDICTED: magnesium transporter MRS2-1-like [Solanum lycopersicum] Length = 445 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MFN P AFKWVLIITGV GA+IF FLWFFKYRRLMPL Sbjct: 408 MFNEPNAFKWVLIITGVTGAVIFFAFLWFFKYRRLMPL 445 >ref|XP_007150818.1| hypothetical protein PHAVU_005G183100g [Phaseolus vulgaris] gi|561024082|gb|ESW22812.1| hypothetical protein PHAVU_005G183100g [Phaseolus vulgaris] Length = 443 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +FN P AF+WVLIITG+CGA IFS F+WFFKYRRLMPL Sbjct: 406 LFNVPSAFQWVLIITGICGAFIFSAFVWFFKYRRLMPL 443 >ref|XP_006356254.1| PREDICTED: magnesium transporter MRS2-1-like [Solanum tuberosum] Length = 445 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MFN P AFKWVLIITGV GA+IF FLWFFKYRRLMPL Sbjct: 408 MFNEPTAFKWVLIITGVTGAVIFFAFLWFFKYRRLMPL 445 >ref|XP_004486600.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Cicer arietinum] gi|502080554|ref|XP_004486601.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Cicer arietinum] Length = 442 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +FN P AF+WVLIITGVCG IFS F+WFFKYRRLMPL Sbjct: 405 LFNVPSAFQWVLIITGVCGVCIFSAFVWFFKYRRLMPL 442 >ref|XP_006493378.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Citrus sinensis] gi|568880996|ref|XP_006493379.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Citrus sinensis] gi|568880998|ref|XP_006493380.1| PREDICTED: magnesium transporter MRS2-1-like isoform X3 [Citrus sinensis] Length = 441 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 F+ P AFKWVLIITGVCG IIF F+WFFKYRRLMPL Sbjct: 405 FDEPAAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 441 >ref|XP_006427652.1| hypothetical protein CICLE_v10025612mg [Citrus clementina] gi|557529642|gb|ESR40892.1| hypothetical protein CICLE_v10025612mg [Citrus clementina] Length = 441 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 6 FNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 F+ P AFKWVLIITGVCG IIF F+WFFKYRRLMPL Sbjct: 405 FDEPAAFKWVLIITGVCGIIIFCAFVWFFKYRRLMPL 441 >ref|XP_004303233.1| PREDICTED: magnesium transporter MRS2-1-like [Fragaria vesca subsp. vesca] Length = 446 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +F++PGAFKWVL+ITGV G IFS F+WFFKYRRLMPL Sbjct: 409 LFDDPGAFKWVLVITGVTGICIFSAFVWFFKYRRLMPL 446 >ref|XP_003543708.1| PREDICTED: magnesium transporter MRS2-1-like isoform X1 [Glycine max] gi|571504011|ref|XP_006595189.1| PREDICTED: magnesium transporter MRS2-1-like isoform X2 [Glycine max] gi|571504014|ref|XP_006595190.1| PREDICTED: magnesium transporter MRS2-1-like isoform X3 [Glycine max] Length = 443 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 +F+ P AF+WVLIITGVCG IFS F+WFFKYRRLMPL Sbjct: 406 LFDVPSAFQWVLIITGVCGVFIFSAFVWFFKYRRLMPL 443 >ref|XP_004160340.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus] Length = 447 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MF NP AFKWVL+ITGV G IIFS F+WFF+Y+RLMPL Sbjct: 410 MFGNPDAFKWVLLITGVSGIIIFSAFVWFFRYKRLMPL 447 >ref|XP_004137654.1| PREDICTED: magnesium transporter MRS2-1-like [Cucumis sativus] Length = 447 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 MFNNPGAFKWVLIITGVCGAIIFSTFLWFFKYRRLMPL 116 MF NP AFKWVL+ITGV G IIFS F+WFF+Y+RLMPL Sbjct: 410 MFGNPDAFKWVLLITGVSGIIIFSAFVWFFRYKRLMPL 447