BLASTX nr result
ID: Mentha25_contig00015630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015630 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29139.1| hypothetical protein MIMGU_mgv1a004255mg [Mimulus... 69 3e-14 >gb|EYU29139.1| hypothetical protein MIMGU_mgv1a004255mg [Mimulus guttatus] Length = 537 Score = 68.6 bits (166), Expect(2) = 3e-14 Identities = 31/53 (58%), Positives = 44/53 (83%) Frame = +1 Query: 205 SVKLAAASSSNRCTSAGEFLRQLSISSVFLIGIGLSRLWAFPHPAFARISPAS 363 S+++AA S++N C+ A +FLR+LS+SSV +IG+G+S LWAFP P+ A ISPAS Sbjct: 37 SIRIAAVSNNNSCSPAADFLRRLSVSSVAIIGLGVSSLWAFPPPSSACISPAS 89 Score = 35.4 bits (80), Expect(2) = 3e-14 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = +3 Query: 75 MSVLSMYSLPGLTYPNPNLTRYRVRS 152 M VLS +LP LTY NPN TR R+RS Sbjct: 1 MPVLSFAALPVLTYSNPNPTRIRIRS 26