BLASTX nr result
ID: Mentha25_contig00015503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015503 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18012.1| hypothetical protein MIMGU_mgv1a002702mg [Mimulus... 98 1e-18 >gb|EYU18012.1| hypothetical protein MIMGU_mgv1a002702mg [Mimulus guttatus] Length = 645 Score = 98.2 bits (243), Expect = 1e-18 Identities = 56/112 (50%), Positives = 70/112 (62%), Gaps = 1/112 (0%) Frame = -1 Query: 476 TPTAVGSNHQRQQSMPSFSEMPYRSEDSTFQLPVLRKTGEKFPPFVEDTFPNEADGTQFQ 297 T VGS+HQ QQS +EM YR E+S F LPVL P + FP +F Sbjct: 539 TAVVVGSSHQGQQSEAGLNEMRYRQEESGFHLPVLPAAETNIP---QGGFPQFVK--EFP 593 Query: 296 SPLKTLSPELPGYEAFNLLFDGTSSLDTGDFDFFE-SLDGSDVGMLMEYFAS 144 SPL +LSP+LPGY FNL FDGTS+LDT DFDF + ++D ++ LM+YFAS Sbjct: 594 SPLNSLSPDLPGYSPFNLQFDGTSALDTDDFDFDDNAVDEANFDELMKYFAS 645