BLASTX nr result
ID: Mentha25_contig00015333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015333 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045981.1| WRKY DNA-binding protein 4, putative isoform... 88 1e-15 ref|XP_007045980.1| WRKY DNA-binding protein 4, putative isoform... 88 1e-15 ref|XP_004168035.1| PREDICTED: probable WRKY transcription facto... 87 2e-15 ref|XP_004135156.1| PREDICTED: probable WRKY transcription facto... 87 2e-15 ref|XP_003613943.1| WRKY transcription factor [Medicago truncatu... 87 2e-15 ref|XP_007157850.1| hypothetical protein PHAVU_002G103400g [Phas... 87 3e-15 ref|NP_001268110.1| DNA binding protein WRKY2 [Vitis vinifera] g... 86 4e-15 emb|CBI36506.3| unnamed protein product [Vitis vinifera] 86 4e-15 gb|AEO31507.2| WRKY transcription factor 2-4 [Dimocarpus longan] 86 7e-15 gb|AEO31519.1| WRKY transcription factor 2-6 [Dimocarpus longan] 86 7e-15 ref|XP_007157703.1| hypothetical protein PHAVU_002G091100g [Phas... 85 1e-14 ref|XP_007157702.1| hypothetical protein PHAVU_002G091100g [Phas... 85 1e-14 gb|AGO62017.1| WRKY [Juglans regia] 85 1e-14 gb|AGJ52151.1| WRKY transcription factor 05 [Jatropha curcas] 85 1e-14 ref|XP_003607772.1| WRKY transcription factor [Medicago truncatu... 85 1e-14 gb|AAF79402.1|AC068197_12 F16A14.18 [Arabidopsis thaliana] 84 2e-14 ref|NP_849658.1| putative WRKY transcription factor 4 [Arabidops... 84 2e-14 pdb|1WJ2|A Chain A, Solution Structure Of The C-Terminal Wrky Do... 84 2e-14 ref|NP_172849.1| putative WRKY transcription factor 4 [Arabidops... 84 2e-14 gb|AGA37230.1| WRKY transcription factor 3.1 [Brassica napus] 84 2e-14 >ref|XP_007045981.1| WRKY DNA-binding protein 4, putative isoform 2 [Theobroma cacao] gi|508709916|gb|EOY01813.1| WRKY DNA-binding protein 4, putative isoform 2 [Theobroma cacao] Length = 529 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/87 (54%), Positives = 51/87 (58%), Gaps = 18/87 (20%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVPXXXXXXXXXXXXXXXQLRLL 182 RSYYKCTTPGCNVRKHVERA+TDPKAVITTYEGKH+H+VP Q+R Sbjct: 443 RSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHDVPAAKTSSHNTANSNASQVRTQ 502 Query: 183 T------------------HLKEEQIT 209 T LKEEQIT Sbjct: 503 TVTNSADFGNNSQQRVAHLRLKEEQIT 529 >ref|XP_007045980.1| WRKY DNA-binding protein 4, putative isoform 1 [Theobroma cacao] gi|508709915|gb|EOY01812.1| WRKY DNA-binding protein 4, putative isoform 1 [Theobroma cacao] Length = 564 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/87 (54%), Positives = 51/87 (58%), Gaps = 18/87 (20%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVPXXXXXXXXXXXXXXXQLRLL 182 RSYYKCTTPGCNVRKHVERA+TDPKAVITTYEGKH+H+VP Q+R Sbjct: 478 RSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHDVPAAKTSSHNTANSNASQVRTQ 537 Query: 183 T------------------HLKEEQIT 209 T LKEEQIT Sbjct: 538 TVTNSADFGNNSQQRVAHLRLKEEQIT 564 >ref|XP_004168035.1| PREDICTED: probable WRKY transcription factor 3-like [Cucumis sativus] Length = 492 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/69 (59%), Positives = 49/69 (71%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVPXXXXXXXXXXXXXXXQLRLL 182 RSYYKCTTPGCNVRKHVERA+TDPKAVITTYEGKH+H+VP QL+ Sbjct: 399 RSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHDVPLGKTSSHSSVSSNISQLKSQ 458 Query: 183 THLKEEQIT 209 + E++I+ Sbjct: 459 NIVTEKKIS 467 >ref|XP_004135156.1| PREDICTED: probable WRKY transcription factor 3-like [Cucumis sativus] Length = 492 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVERA+TDPKAVITTYEGKH+H+VP Sbjct: 399 RSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHDVP 438 >ref|XP_003613943.1| WRKY transcription factor [Medicago truncatula] gi|355515278|gb|AES96901.1| WRKY transcription factor [Medicago truncatula] Length = 433 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVERA+TDPKAVITTYEGKH+H+VP Sbjct: 340 RSYYKCTTPGCNVRKHVERASTDPKAVITTYEGKHNHDVP 379 >ref|XP_007157850.1| hypothetical protein PHAVU_002G103400g [Phaseolus vulgaris] gi|561031265|gb|ESW29844.1| hypothetical protein PHAVU_002G103400g [Phaseolus vulgaris] Length = 437 Score = 86.7 bits (213), Expect = 3e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVERA+TDPKAV+TTYEGKH+H+VP Sbjct: 348 RSYYKCTTPGCNVRKHVERASTDPKAVVTTYEGKHNHDVP 387 >ref|NP_001268110.1| DNA binding protein WRKY2 [Vitis vinifera] gi|48686707|gb|AAT46067.1| DNA binding protein WRKY2 [Vitis vinifera] Length = 536 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCT PGCNVRKHVERAATDPKAVITTYEGKH+H+VP Sbjct: 449 RSYYKCTNPGCNVRKHVERAATDPKAVITTYEGKHNHDVP 488 >emb|CBI36506.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCT PGCNVRKHVERAATDPKAVITTYEGKH+H+VP Sbjct: 380 RSYYKCTNPGCNVRKHVERAATDPKAVITTYEGKHNHDVP 419 >gb|AEO31507.2| WRKY transcription factor 2-4 [Dimocarpus longan] Length = 531 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVERA++DPKAVITTYEGKH+H+VP Sbjct: 447 RSYYKCTTPGCNVRKHVERASSDPKAVITTYEGKHNHDVP 486 >gb|AEO31519.1| WRKY transcription factor 2-6 [Dimocarpus longan] Length = 102 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVERA++DPKAVITTYEGKH+H+VP Sbjct: 18 RSYYKCTTPGCNVRKHVERASSDPKAVITTYEGKHNHDVP 57 >ref|XP_007157703.1| hypothetical protein PHAVU_002G091100g [Phaseolus vulgaris] gi|561031118|gb|ESW29697.1| hypothetical protein PHAVU_002G091100g [Phaseolus vulgaris] Length = 362 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERA+TDPKAVITTYEGKH+H+VP Sbjct: 271 RSYYKCTTPGCKVRKHVERASTDPKAVITTYEGKHNHDVP 310 >ref|XP_007157702.1| hypothetical protein PHAVU_002G091100g [Phaseolus vulgaris] gi|561031117|gb|ESW29696.1| hypothetical protein PHAVU_002G091100g [Phaseolus vulgaris] Length = 454 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERA+TDPKAVITTYEGKH+H+VP Sbjct: 363 RSYYKCTTPGCKVRKHVERASTDPKAVITTYEGKHNHDVP 402 >gb|AGO62017.1| WRKY [Juglans regia] Length = 517 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCT PGCNVRKHVERA+TDPKAVITTYEGKH+H++P Sbjct: 428 RSYYKCTNPGCNVRKHVERASTDPKAVITTYEGKHNHDIP 467 >gb|AGJ52151.1| WRKY transcription factor 05 [Jatropha curcas] Length = 477 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAATDPKAVITTYEGKH+H++P Sbjct: 388 RSYYKCTTPGCKVRKHVERAATDPKAVITTYEGKHNHDLP 427 >ref|XP_003607772.1| WRKY transcription factor [Medicago truncatula] gi|355508827|gb|AES89969.1| WRKY transcription factor [Medicago truncatula] Length = 388 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGCNVRKHVER +TDPKAV+TTYEGKH+H+VP Sbjct: 298 RSYYKCTTPGCNVRKHVERVSTDPKAVLTTYEGKHNHDVP 337 >gb|AAF79402.1|AC068197_12 F16A14.18 [Arabidopsis thaliana] Length = 571 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAATDPKAV+TTYEGKH+H++P Sbjct: 486 RSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLP 525 >ref|NP_849658.1| putative WRKY transcription factor 4 [Arabidopsis thaliana] gi|5080772|gb|AAD39282.1|AC007576_5 Similar to DNA-binding proteins [Arabidopsis thaliana] gi|13506741|gb|AAK28313.1|AF224703_1 WRKY DNA-binding protein 4 [Arabidopsis thaliana] gi|332190969|gb|AEE29090.1| putative WRKY transcription factor 4 [Arabidopsis thaliana] Length = 487 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAATDPKAV+TTYEGKH+H++P Sbjct: 402 RSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLP 441 >pdb|1WJ2|A Chain A, Solution Structure Of The C-Terminal Wrky Domain Of Atwrky4 gi|372466725|pdb|2LEX|A Chain A, Complex Of The C-Terminal Wrky Domain Of Atwrky4 And A W-Box Dna Length = 78 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAATDPKAV+TTYEGKH+H++P Sbjct: 38 RSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLP 77 >ref|NP_172849.1| putative WRKY transcription factor 4 [Arabidopsis thaliana] gi|20978796|sp|Q9XI90.2|WRKY4_ARATH RecName: Full=Probable WRKY transcription factor 4; AltName: Full=WRKY DNA-binding protein 4 gi|15991742|gb|AAL13048.1|AF425835_1 WRKY transcription factor 4 [Arabidopsis thaliana] gi|15010750|gb|AAK74034.1| At1g13960/F7A19_5 [Arabidopsis thaliana] gi|27363252|gb|AAO11545.1| At1g13960/F7A19_5 [Arabidopsis thaliana] gi|332190968|gb|AEE29089.1| putative WRKY transcription factor 4 [Arabidopsis thaliana] Length = 514 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAATDPKAV+TTYEGKH+H++P Sbjct: 429 RSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLP 468 >gb|AGA37230.1| WRKY transcription factor 3.1 [Brassica napus] Length = 489 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 RSYYKCTTPGCNVRKHVERAATDPKAVITTYEGKHSHEVP 122 RSYYKCTTPGC VRKHVERAA+DPKAV+TTYEGKH+H+VP Sbjct: 410 RSYYKCTTPGCGVRKHVERAASDPKAVVTTYEGKHNHDVP 449