BLASTX nr result
ID: Mentha25_contig00015167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00015167 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26753.1| hypothetical protein MIMGU_mgv1a026671mg [Mimulus... 73 4e-11 emb|CBI28265.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2... 64 3e-08 emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] 64 3e-08 gb|EXC01923.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] 63 4e-08 ref|XP_007200146.1| hypothetical protein PRUPE_ppa016981mg [Prun... 62 8e-08 ref|XP_002312826.2| hypothetical protein POPTR_0009s16390g [Popu... 61 2e-07 ref|XP_007207956.1| hypothetical protein PRUPE_ppa016929mg [Prun... 61 2e-07 ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223... 61 2e-07 ref|XP_003518193.2| PREDICTED: aspartic proteinase nepenthesin-2... 60 3e-07 ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phas... 60 3e-07 ref|XP_007145803.1| hypothetical protein PHAVU_007G269300g [Phas... 60 3e-07 ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1... 59 5e-07 ref|XP_002523869.1| Aspartic proteinase nepenthesin-2 precursor,... 59 5e-07 ref|XP_002309394.1| aspartyl protease family protein [Populus tr... 59 5e-07 gb|ABK94196.1| unknown [Populus trichocarpa] 59 5e-07 ref|XP_004303503.1| PREDICTED: aspartic proteinase nepenthesin-2... 59 7e-07 ref|XP_006361102.1| PREDICTED: aspartic proteinase nepenthesin-1... 59 9e-07 ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutr... 59 9e-07 ref|XP_004241344.1| PREDICTED: aspartic proteinase nepenthesin-2... 59 9e-07 >gb|EYU26753.1| hypothetical protein MIMGU_mgv1a026671mg [Mimulus guttatus] Length = 382 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 ELV GP+VILGNFLMQNFHVE+DLRNERFGFRQQ CS Sbjct: 346 ELVGGPSVILGNFLMQNFHVEFDLRNERFGFRQQYCS 382 >emb|CBI28265.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 E GPA+ILGNF QNF+VEYDLRNER GFRQQSC+ Sbjct: 350 EFSGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSCN 386 >ref|XP_002272243.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 467 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E GPA+ILGNF QNF+VEYDLRNER GFRQQSC Sbjct: 431 EFSGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSC 466 >emb|CAN79938.1| hypothetical protein VITISV_027777 [Vitis vinifera] Length = 454 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E GPA+ILGNF QNF+VEYDLRNER GFRQQSC Sbjct: 418 EFSGGPAIILGNFQQQNFYVEYDLRNERLGFRQQSC 453 >gb|EXC01923.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] Length = 473 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E V GPA+ILGN+ QNFH+EYDL+NERFGFR+Q C Sbjct: 437 ESVGGPAIILGNYQQQNFHIEYDLKNERFGFRRQIC 472 >ref|XP_007200146.1| hypothetical protein PRUPE_ppa016981mg [Prunus persica] gi|462395546|gb|EMJ01345.1| hypothetical protein PRUPE_ppa016981mg [Prunus persica] Length = 460 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 324 SGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 SGP+++LG+F MQN+HVEYDL+NERFGF+QQ C+ Sbjct: 427 SGPSIVLGSFQMQNYHVEYDLQNERFGFKQQECN 460 >ref|XP_002312826.2| hypothetical protein POPTR_0009s16390g [Populus trichocarpa] gi|550331863|gb|EEE86781.2| hypothetical protein POPTR_0009s16390g [Populus trichocarpa] Length = 462 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E V GP +ILGNF MQNF+VEYDLRNER GF+Q+ C Sbjct: 426 ERVGGPGMILGNFQMQNFYVEYDLRNERLGFKQEKC 461 >ref|XP_007207956.1| hypothetical protein PRUPE_ppa016929mg [Prunus persica] gi|462403598|gb|EMJ09155.1| hypothetical protein PRUPE_ppa016929mg [Prunus persica] Length = 463 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 324 SGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 SGP++ILG+F MQN+HVE+DL+NERFGF+QQ C+ Sbjct: 430 SGPSIILGSFQMQNYHVEFDLQNERFGFKQQQCN 463 >ref|XP_002534234.1| pepsin A, putative [Ricinus communis] gi|223525662|gb|EEF28148.1| pepsin A, putative [Ricinus communis] Length = 468 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 324 SGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 SGPA+ILGNF QNF++EYDL N+RFGF++QSC+ Sbjct: 435 SGPAIILGNFQQQNFYIEYDLENDRFGFKEQSCA 468 >ref|XP_003518193.2| PREDICTED: aspartic proteinase nepenthesin-2-like [Glycine max] Length = 478 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 321 GPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 GPAVILGN+ QNF+VEYDL NERFGFR QSC Sbjct: 443 GPAVILGNYQQQNFYVEYDLENERFGFRSQSC 474 >ref|XP_007162958.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] gi|561036422|gb|ESW34952.1| hypothetical protein PHAVU_001G194500g [Phaseolus vulgaris] Length = 466 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 324 SGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 SGPA+ILGN+ QNFH+EYDL NERFGF QSC Sbjct: 430 SGPAIILGNYQQQNFHIEYDLENERFGFGPQSC 462 >ref|XP_007145803.1| hypothetical protein PHAVU_007G269300g [Phaseolus vulgaris] gi|561018993|gb|ESW17797.1| hypothetical protein PHAVU_007G269300g [Phaseolus vulgaris] Length = 458 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 330 LVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 + +GPAVILGN+ QNF+VEYDL NERFGFR QSC Sbjct: 420 VAAGPAVILGNYQQQNFYVEYDLGNERFGFRSQSC 454 >ref|XP_006481530.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Citrus sinensis] Length = 465 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E GPA+ILGNF MQN++VEYDLRN+R GF+QQ C Sbjct: 429 EASGGPAIILGNFQMQNYYVEYDLRNQRLGFKQQLC 464 >ref|XP_002523869.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223536957|gb|EEF38595.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 447 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 E SGP +ILGNF MQNF+VEYDL+NER GF+++SC Sbjct: 411 EKASGPGMILGNFQMQNFYVEYDLQNERLGFKKESC 446 >ref|XP_002309394.1| aspartyl protease family protein [Populus trichocarpa] gi|222855370|gb|EEE92917.1| aspartyl protease family protein [Populus trichocarpa] Length = 469 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 321 GPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 GPA+ILGN+ +NFHVE+DL+NERFGF+QQ+C Sbjct: 436 GPAIILGNYQQRNFHVEFDLKNERFGFKQQNC 467 >gb|ABK94196.1| unknown [Populus trichocarpa] Length = 125 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 321 GPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 GPA+ILGN+ +NFHVE+DL+NERFGF+QQ+C Sbjct: 92 GPAIILGNYQQRNFHVEFDLKNERFGFKQQNC 123 >ref|XP_004303503.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Fragaria vesca subsp. vesca] Length = 458 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 330 LVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 + +GPAVILGNF QNF+VEYDL ERFGF++QSC Sbjct: 422 VAAGPAVILGNFQQQNFYVEYDLERERFGFKKQSC 456 >ref|XP_006361102.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum tuberosum] Length = 460 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 EL +GP++ILGNF MQN+ VE+DL+NE+FGF+QQ C Sbjct: 424 ELSTGPSIILGNFQMQNYLVEFDLKNEKFGFKQQMC 459 >ref|XP_006403798.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] gi|557104917|gb|ESQ45251.1| hypothetical protein EUTSA_v10010339mg [Eutrema salsugineum] Length = 471 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 324 SGPAVILGNFLMQNFHVEYDLRNERFGFRQQSCS 223 SGPA+ILG+F QN+HVEYDL N+RFGF Q+ CS Sbjct: 437 SGPAIILGSFQQQNYHVEYDLENDRFGFAQKKCS 470 >ref|XP_004241344.1| PREDICTED: aspartic proteinase nepenthesin-2-like isoform 1 [Solanum lycopersicum] Length = 461 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -3 Query: 333 ELVSGPAVILGNFLMQNFHVEYDLRNERFGFRQQSC 226 EL +GP++ILGNF MQN+ VE+DL+NE+FGF+QQ C Sbjct: 425 ELSTGPSIILGNFQMQNYLVEFDLKNEKFGFKQQMC 460