BLASTX nr result
ID: Mentha25_contig00014482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014482 (879 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43762.1| hypothetical protein MIMGU_mgv1a025785mg [Mimulus... 72 4e-10 ref|XP_002528341.1| calcium ion binding protein, putative [Ricin... 57 7e-06 >gb|EYU43762.1| hypothetical protein MIMGU_mgv1a025785mg [Mimulus guttatus] Length = 193 Score = 71.6 bits (174), Expect = 4e-10 Identities = 33/54 (61%), Positives = 38/54 (70%) Frame = -1 Query: 879 GIFFSCVQCFNANPKSAFDICHHCYKSKICKHSHGRGRALFLDNYTLLHATRHS 718 GIFFSCV+CFN + + FD+C CYK+K CKH H GR FLDNYTLL R S Sbjct: 102 GIFFSCVECFNDSSGAPFDLCPVCYKAKSCKHEHD-GRFQFLDNYTLLETKRDS 154 >ref|XP_002528341.1| calcium ion binding protein, putative [Ricinus communis] gi|223532209|gb|EEF34013.1| calcium ion binding protein, putative [Ricinus communis] Length = 183 Score = 57.4 bits (137), Expect = 7e-06 Identities = 34/88 (38%), Positives = 48/88 (54%) Frame = -1 Query: 879 GIFFSCVQCFNANPKSAFDICHHCYKSKICKHSHGRGRALFLDNYTLLHATRHSPTSTTI 700 G++F+CVQCFN + + +D+C CY+ K H ALFLDNYTLL A R Sbjct: 102 GVYFTCVQCFNGS-GNTYDLCSSCYRDKNINHHKD---ALFLDNYTLLQAKR-------- 149 Query: 699 VNQYQATPSRRHGKSPQEDASVSTSKFV 616 Q +A+ S+R + + A V T+ V Sbjct: 150 -QQNKASGSQRKSGASEAIALVETTSNV 176