BLASTX nr result
ID: Mentha25_contig00014404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014404 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324203.1| small MutS related domain-containing family ... 83 3e-14 gb|EXB74914.1| hypothetical protein L484_018623 [Morus notabilis] 83 4e-14 gb|EYU32334.1| hypothetical protein MIMGU_mgv1a003899mg [Mimulus... 81 1e-13 ref|XP_004305608.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 81 2e-13 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_006452962.1| hypothetical protein CICLE_v10007851mg [Citr... 80 3e-13 ref|XP_006293908.1| hypothetical protein CARUB_v10022901mg [Caps... 80 3e-13 ref|XP_006293907.1| hypothetical protein CARUB_v10022901mg [Caps... 80 3e-13 ref|XP_003550222.1| PREDICTED: protein CTC-INTERACTING DOMAIN 7-... 80 3e-13 ref|XP_002880772.1| hypothetical protein ARALYDRAFT_481487 [Arab... 80 3e-13 ref|XP_002516159.1| pentatricopeptide repeat-containing protein,... 80 3e-13 ref|XP_002309456.1| small MutS related domain-containing family ... 80 3e-13 gb|ABK96374.1| unknown [Populus trichocarpa x Populus deltoides] 80 3e-13 dbj|BAF00529.1| hypothetical protein [Arabidopsis thaliana] 80 3e-13 ref|NP_180196.1| protein CTC-interacting domain 7 [Arabidopsis t... 80 3e-13 gb|EPS65524.1| hypothetical protein M569_09253 [Genlisea aurea] 79 6e-13 ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 emb|CBI20737.3| unnamed protein product [Vitis vinifera] 79 6e-13 ref|XP_007012460.1| CTC-interacting domain 7 isoform 3 [Theobrom... 79 8e-13 >ref|XP_002324203.1| small MutS related domain-containing family protein [Populus trichocarpa] gi|222865637|gb|EEF02768.1| small MutS related domain-containing family protein [Populus trichocarpa] Length = 583 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRGARTPARLP AVQRYLLEEEGLDY+EPQPGLL Sbjct: 539 VGTGHHTRGARTPARLPVAVQRYLLEEEGLDYTEPQPGLL 578 >gb|EXB74914.1| hypothetical protein L484_018623 [Morus notabilis] Length = 567 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQPGLL Sbjct: 524 VGTGHHTRGSRTPARLPIAVQRYLLEEEGLDYSEPQPGLL 563 >gb|EYU32334.1| hypothetical protein MIMGU_mgv1a003899mg [Mimulus guttatus] Length = 556 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLPTAVQRYLLE+EGLD++EPQPGLL Sbjct: 512 VGTGHHTRGSRTPARLPTAVQRYLLEDEGLDFTEPQPGLL 551 >ref|XP_004305608.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Fragaria vesca subsp. vesca] Length = 1625 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGL+YSEPQPGLL Sbjct: 528 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLNYSEPQPGLL 567 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYL+EEEGLD+SEPQPGLL Sbjct: 534 VGTGHHTRGSRTPARLPVAVQRYLIEEEGLDFSEPQPGLL 573 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYL+EEEGLD+SEPQPGLL Sbjct: 534 VGTGHHTRGSRTPARLPVAVQRYLIEEEGLDFSEPQPGLL 573 >ref|XP_006452962.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|567921928|ref|XP_006452970.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556188|gb|ESR66202.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] gi|557556196|gb|ESR66210.1| hypothetical protein CICLE_v10007851mg [Citrus clementina] Length = 574 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTP RLP AVQRYLLEEEGLDY+EPQPGLL Sbjct: 530 VGTGHHTRGSRTPVRLPIAVQRYLLEEEGLDYTEPQPGLL 569 >ref|XP_006293908.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|482562616|gb|EOA26806.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] Length = 550 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQ GLL Sbjct: 506 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLL 545 >ref|XP_006293907.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|565472214|ref|XP_006293909.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|565472216|ref|XP_006293910.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|482562615|gb|EOA26805.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|482562617|gb|EOA26807.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] gi|482562618|gb|EOA26808.1| hypothetical protein CARUB_v10022901mg [Capsella rubella] Length = 574 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQ GLL Sbjct: 530 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLL 569 >ref|XP_003550222.1| PREDICTED: protein CTC-INTERACTING DOMAIN 7-like isoform 1 [Glycine max] gi|356563956|ref|XP_003550223.1| PREDICTED: protein CTC-INTERACTING DOMAIN 7-like isoform 2 [Glycine max] Length = 573 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLD++EPQPGLL Sbjct: 529 VGTGHHTRGSRTPARLPIAVQRYLLEEEGLDFTEPQPGLL 568 >ref|XP_002880772.1| hypothetical protein ARALYDRAFT_481487 [Arabidopsis lyrata subsp. lyrata] gi|297326611|gb|EFH57031.1| hypothetical protein ARALYDRAFT_481487 [Arabidopsis lyrata subsp. lyrata] Length = 570 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQ GLL Sbjct: 526 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLL 565 >ref|XP_002516159.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544645|gb|EEF46161.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1439 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQ+YLLEEEGLDY+EPQPGLL Sbjct: 540 VGTGHHTRGSRTPARLPIAVQQYLLEEEGLDYTEPQPGLL 579 >ref|XP_002309456.1| small MutS related domain-containing family protein [Populus trichocarpa] gi|222855432|gb|EEE92979.1| small MutS related domain-containing family protein [Populus trichocarpa] Length = 581 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDY+EP PGLL Sbjct: 537 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYTEPHPGLL 576 >gb|ABK96374.1| unknown [Populus trichocarpa x Populus deltoides] Length = 581 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDY+EP PGLL Sbjct: 537 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYTEPHPGLL 576 >dbj|BAF00529.1| hypothetical protein [Arabidopsis thaliana] Length = 567 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQ GLL Sbjct: 523 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLL 562 >ref|NP_180196.1| protein CTC-interacting domain 7 [Arabidopsis thaliana] gi|75099225|sp|O64843.1|CID7_ARATH RecName: Full=Protein CTC-INTERACTING DOMAIN 7 gi|3075391|gb|AAC14523.1| unknown protein [Arabidopsis thaliana] gi|133778822|gb|ABO38751.1| At2g26280 [Arabidopsis thaliana] gi|330252724|gb|AEC07818.1| CTC-interacting domain 7 protein [Arabidopsis thaliana] Length = 567 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDYSEPQ GLL Sbjct: 523 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLL 562 >gb|EPS65524.1| hypothetical protein M569_09253 [Genlisea aurea] Length = 576 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGL +SEPQPGLL Sbjct: 532 VGTGHHTRGSRTPARLPAAVQRYLLEEEGLHFSEPQPGLL 571 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDY+EPQ GLL Sbjct: 531 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYTEPQAGLL 570 >emb|CBI20737.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEEGLDY+EPQ GLL Sbjct: 480 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYTEPQAGLL 519 >ref|XP_007012460.1| CTC-interacting domain 7 isoform 3 [Theobroma cacao] gi|508782823|gb|EOY30079.1| CTC-interacting domain 7 isoform 3 [Theobroma cacao] Length = 546 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 320 VGTGHHTRGARTPARLPTAVQRYLLEEEGLDYSEPQPGLL 201 VGTGHHTRG+RTPARLP AVQRYLLEEE LDY+EPQPGLL Sbjct: 502 VGTGHHTRGSRTPARLPVAVQRYLLEEECLDYTEPQPGLL 541