BLASTX nr result
ID: Mentha25_contig00014395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014395 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27177.1| hypothetical protein MIMGU_mgv1a003367mg [Mimulus... 66 6e-09 >gb|EYU27177.1| hypothetical protein MIMGU_mgv1a003367mg [Mimulus guttatus] Length = 589 Score = 65.9 bits (159), Expect = 6e-09 Identities = 41/112 (36%), Positives = 58/112 (51%) Frame = -3 Query: 379 LELEKVPSLDTHQIPFVAERPLTYVGAVGPPSEIHLGPNMDETNLLTSEDTVITXXXXXX 200 L+L+K+ SL P + + LTYVG+VGPPSEI+LG N+D+ L+TS++ VIT Sbjct: 93 LDLDKLTSL-----PVASNKTLTYVGSVGPPSEINLGANLDKEALITSDEAVITAAASEA 147 Query: 199 XXXXXXXXXXXXXXSMMISLHXXXXXXXXXTGVLPEVDTHPVETIFREAKVG 44 +MM+SLH EVDT + REA++G Sbjct: 148 LALAKAAVKVAKDAAMMVSLHRSTKPDTKS---FLEVDTSAERVVVREAEIG 196