BLASTX nr result
ID: Mentha25_contig00014388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014388 (534 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17757.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus... 59 7e-07 gb|EYU17756.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus... 59 7e-07 gb|EYU17755.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus... 59 7e-07 ref|XP_006344490.1| PREDICTED: serine/threonine-protein kinase A... 59 7e-07 ref|XP_006344489.1| PREDICTED: serine/threonine-protein kinase A... 59 7e-07 ref|XP_004236278.1| PREDICTED: serine/threonine-protein kinase A... 59 7e-07 gb|EXB94464.1| Serine/threonine-protein kinase AFC2 [Morus notab... 59 9e-07 ref|XP_004309989.1| PREDICTED: serine/threonine-protein kinase A... 59 9e-07 ref|XP_006439955.1| hypothetical protein CICLE_v10020223mg [Citr... 57 4e-06 ref|XP_006439954.1| hypothetical protein CICLE_v10020223mg [Citr... 57 4e-06 ref|XP_006439953.1| hypothetical protein CICLE_v10020223mg [Citr... 57 4e-06 ref|XP_006439952.1| hypothetical protein CICLE_v10020223mg [Citr... 57 4e-06 ref|XP_002530054.1| afc, putative [Ricinus communis] gi|22353047... 56 5e-06 ref|XP_002511301.1| afc, putative [Ricinus communis] gi|22355041... 56 6e-06 >gb|EYU17757.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus guttatus] Length = 347 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLL+++PSERMSA+EAL+H FFTRDH RRY Sbjct: 316 LQGLLRYDPSERMSADEALKHSFFTRDHFRRY 347 >gb|EYU17756.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus guttatus] Length = 429 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLL+++PSERMSA+EAL+H FFTRDH RRY Sbjct: 398 LQGLLRYDPSERMSADEALKHSFFTRDHFRRY 429 >gb|EYU17755.1| hypothetical protein MIMGU_mgv1a006818mg [Mimulus guttatus] Length = 430 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLL+++PSERMSA+EAL+H FFTRDH RRY Sbjct: 399 LQGLLRYDPSERMSADEALKHSFFTRDHFRRY 430 >ref|XP_006344490.1| PREDICTED: serine/threonine-protein kinase AFC2-like isoform X2 [Solanum tuberosum] Length = 328 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++PSER++A EALRHPFFTRDHLRR Sbjct: 298 LQGLLRYDPSERLTAREALRHPFFTRDHLRR 328 >ref|XP_006344489.1| PREDICTED: serine/threonine-protein kinase AFC2-like isoform X1 [Solanum tuberosum] Length = 432 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++PSER++A EALRHPFFTRDHLRR Sbjct: 402 LQGLLRYDPSERLTAREALRHPFFTRDHLRR 432 >ref|XP_004236278.1| PREDICTED: serine/threonine-protein kinase AFC2-like [Solanum lycopersicum] Length = 432 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++PSER++A EALRHPFFTRDHLRR Sbjct: 402 LQGLLRYDPSERLTAREALRHPFFTRDHLRR 432 >gb|EXB94464.1| Serine/threonine-protein kinase AFC2 [Morus notabilis] Length = 903 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLLK++PS+R++A EALRHPFF+RDHLRRY Sbjct: 387 LQGLLKYDPSDRLTACEALRHPFFSRDHLRRY 418 >ref|XP_004309989.1| PREDICTED: serine/threonine-protein kinase AFC2-like [Fragaria vesca subsp. vesca] Length = 432 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLL+FEPS R++A EALRHPFFTRDH RR+ Sbjct: 401 LQGLLRFEPSNRLTASEALRHPFFTRDHYRRF 432 >ref|XP_006439955.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542217|gb|ESR53195.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 338 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++P++R++A EALRHPFFTRDHLRR Sbjct: 308 LQGLLRYDPTDRLTAREALRHPFFTRDHLRR 338 >ref|XP_006439954.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542216|gb|ESR53194.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 430 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++P++R++A EALRHPFFTRDHLRR Sbjct: 400 LQGLLRYDPTDRLTAREALRHPFFTRDHLRR 430 >ref|XP_006439953.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542215|gb|ESR53193.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 433 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++P++R++A EALRHPFFTRDHLRR Sbjct: 403 LQGLLRYDPTDRLTAREALRHPFFTRDHLRR 433 >ref|XP_006439952.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] gi|557542214|gb|ESR53192.1| hypothetical protein CICLE_v10020223mg [Citrus clementina] Length = 329 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++P++R++A EALRHPFFTRDHLRR Sbjct: 299 LQGLLRYDPTDRLTAREALRHPFFTRDHLRR 329 >ref|XP_002530054.1| afc, putative [Ricinus communis] gi|223530470|gb|EEF32354.1| afc, putative [Ricinus communis] Length = 432 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRRY 98 LQGLL+++PS R++A EALRHPFFTRDH RR+ Sbjct: 401 LQGLLRYDPSNRLTAHEALRHPFFTRDHYRRF 432 >ref|XP_002511301.1| afc, putative [Ricinus communis] gi|223550416|gb|EEF51903.1| afc, putative [Ricinus communis] Length = 435 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 3 LQGLLKFEPSERMSAEEALRHPFFTRDHLRR 95 LQGLL+++PS+R++A EALRHPFF RDHLRR Sbjct: 405 LQGLLRYDPSDRLTAREALRHPFFARDHLRR 435