BLASTX nr result
ID: Mentha25_contig00014341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014341 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23285.1| hypothetical protein MIMGU_mgv1a004410mg [Mimulus... 66 4e-09 >gb|EYU23285.1| hypothetical protein MIMGU_mgv1a004410mg [Mimulus guttatus] Length = 528 Score = 66.2 bits (160), Expect = 4e-09 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 1/56 (1%) Frame = +3 Query: 177 LVDPRKSDTKRSVAVKSAGSEGALTSA-SLQSTAVKLLHLVVSLGIILAVDKLLKQ 341 LVDP+ ++R V+VKS SE LTSA SLQST VKLLHLVVSLGII+A+DK LKQ Sbjct: 76 LVDPQIIHSQRRVSVKSNESETGLTSATSLQSTVVKLLHLVVSLGIIVAMDKFLKQ 131