BLASTX nr result
ID: Mentha25_contig00014160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014160 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18735.1| hypothetical protein MIMGU_mgv1a012994mg [Mimulus... 57 3e-06 >gb|EYU18735.1| hypothetical protein MIMGU_mgv1a012994mg [Mimulus guttatus] Length = 233 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 396 DGTVHNLYEYMAMYSLGVMKSIGTDAIDTVLTQKLGAL 283 DGTVHNL EYM M SL +KSIG D +DT+LTQKLG L Sbjct: 182 DGTVHNLNEYMEMSSLDTVKSIGDDTVDTLLTQKLGVL 219