BLASTX nr result
ID: Mentha25_contig00014084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014084 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Mimulus... 56 5e-06 >gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Mimulus guttatus] Length = 583 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 124 MLSAVRSLALLVIFFAFVASPVFGKYKDGDPVTLWVNKVGP 2 M S+VRS + V FFAF+ S GKY+D + VTLWVNKVGP Sbjct: 1 MFSSVRSFCIFVFFFAFLVSSSLGKYQDDEAVTLWVNKVGP 41