BLASTX nr result
ID: Mentha25_contig00013662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00013662 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21001.1| hypothetical protein MIMGU_mgv1a011084mg [Mimulus... 63 5e-08 >gb|EYU21001.1| hypothetical protein MIMGU_mgv1a011084mg [Mimulus guttatus] Length = 293 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 320 RAQANKGDWNNSWPWYLDSFFDKFADSNSEDGEDFQ 213 RA ANKGD+N PWYLD+FFD FADSN EDGED Q Sbjct: 256 RAHANKGDFNEKSPWYLDTFFDHFADSNCEDGEDLQ 291