BLASTX nr result
ID: Mentha25_contig00013534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00013534 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23834.1| hypothetical protein MIMGU_mgv1a009849mg [Mimulus... 62 6e-08 gb|EYU17407.1| hypothetical protein MIMGU_mgv1a011877mg [Mimulus... 56 6e-06 >gb|EYU23834.1| hypothetical protein MIMGU_mgv1a009849mg [Mimulus guttatus] Length = 329 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 531 SFLAWIGLSFWRDSKAHGLSSPFASLKELIFGP 433 SF AWIGLSFW+D++AHGLSSP SLKEL+FGP Sbjct: 297 SFAAWIGLSFWKDAQAHGLSSPLTSLKELVFGP 329 >gb|EYU17407.1| hypothetical protein MIMGU_mgv1a011877mg [Mimulus guttatus] Length = 268 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 528 FLAWIGLSFWRDSKAHGLSSPFASLKELIFG 436 FLAWIG++ WRD+K HG +SPF+SLKE+IFG Sbjct: 237 FLAWIGITVWRDAKVHGYNSPFSSLKEMIFG 267