BLASTX nr result
ID: Mentha25_contig00011830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011830 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus... 101 1e-19 ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citr... 60 4e-07 ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Cit... 58 1e-06 ref|XP_002531125.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 gb|EXC68150.1| F-box protein [Morus notabilis] 55 8e-06 >gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus guttatus] Length = 375 Score = 101 bits (251), Expect = 1e-19 Identities = 51/61 (83%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = +1 Query: 169 EDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIP-QKKSGVKES 345 +D FDRLPD+VVLSIF KLQDARSLCLSMAACKRFRSIAPQV IFLP+P QKKS +KES Sbjct: 18 DDSFDRLPDEVVLSIFEKLQDARSLCLSMAACKRFRSIAPQVGEIFLPVPHQKKSAIKES 77 Query: 346 D 348 D Sbjct: 78 D 78 >ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] gi|557548859|gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] Length = 389 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 7/93 (7%) Frame = +1 Query: 100 FDSHSSQTPKSTMDSSSEQILHSE----DFFDRLPDDVVLSIFVKLQDARSLCLSMAACK 267 F+ ++ P ++ E+I+ E D+FD LPD ++L IF KL DA+SL + CK Sbjct: 30 FEYSQAKQPIKRKNNQMERIVLQEEKADDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCK 89 Query: 268 RFRSIAPQVDRIFL---PIPQKKSGVKESDQKN 357 RF S+ PQ++ +FL P P+++ + S +++ Sbjct: 90 RFSSLIPQINNLFLSIIPRPRRQVLIGNSSKRS 122 >ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis] Length = 345 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Frame = +1 Query: 136 MDSSSEQILHSEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFL-- 309 M+ +Q +D+FD LPD ++L IF KL DA+SL + CKRF S+ PQ++ +FL Sbjct: 1 MERIVQQEEKPDDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSLIPQINNLFLSI 60 Query: 310 -PIPQKKSGVKESDQKN 357 P P+++ + S +++ Sbjct: 61 IPRPRRQVLIGNSSKRS 77 >ref|XP_002531125.1| conserved hypothetical protein [Ricinus communis] gi|223529289|gb|EEF31259.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = +1 Query: 166 SEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIPQKK 327 +EDFFD LPD ++L IF KL D+RSL + KRF S+ Q D +FL IP K Sbjct: 11 NEDFFDPLPDSLLLLIFNKLCDSRSLAQCLLVSKRFSSLVFQADNVFLSIPTPK 64 >gb|EXC68150.1| F-box protein [Morus notabilis] Length = 352 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = +1 Query: 163 HSEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIPQKKS 330 H D+FD+LPD ++ IF K+ DA++L + KRF S+ Q D +FLP+P +K+ Sbjct: 19 HRRDYFDQLPDPLLHLIFNKILDAKTLVRCLPVSKRFNSLISQTDAVFLPLPPQKN 74