BLASTX nr result
ID: Mentha25_contig00011363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011363 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Mimulus... 56 4e-06 >gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Mimulus guttatus] Length = 160 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 NTRFANALGFLKKTPLASCSQILKQYQESEE 95 NTRFANA+GFL TPLASC +ILKQYQESE+ Sbjct: 130 NTRFANAMGFLANTPLASCQEILKQYQESED 160