BLASTX nr result
ID: Mentha25_contig00011232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011232 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36579.1| hypothetical protein MIMGU_mgv1a008197mg [Mimulus... 82 6e-14 ref|XP_006368989.1| hypothetical protein POPTR_0001s15470g [Popu... 74 3e-11 gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsu... 69 5e-10 ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily pr... 69 9e-10 gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] 66 6e-09 ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_007212439.1| hypothetical protein PRUPE_ppa016777mg, part... 63 5e-08 ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citr... 62 8e-08 ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_002531466.1| pentatricopeptide repeat-containing protein,... 61 2e-07 ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phas... 59 7e-07 ref|XP_003604902.1| Pentatricopeptide repeat-containing protein ... 58 2e-06 gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] 57 2e-06 ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 emb|CBI25851.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >gb|EYU36579.1| hypothetical protein MIMGU_mgv1a008197mg [Mimulus guttatus] Length = 381 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/75 (53%), Positives = 57/75 (76%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 I+R +V EGRV+DGFR+F ++K GNL++V D+YS+LL+ LC+EN EA +VSVMVE Sbjct: 288 IIRTMVLEGRVMDGFRVFDALQKSGNLVAVHSDVYSNLLAGLCEENCFVEAARIVSVMVE 347 Query: 183 RRIHLEPSHCENLIK 227 RI L+ + EN+I+ Sbjct: 348 GRIRLKSTCAENIIE 362 >ref|XP_006368989.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] gi|550347348|gb|ERP65558.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] Length = 476 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + SE RVLDGF L++EVEK G L S+D DIYS LL+ LCQ+ EA L M+E Sbjct: 383 MIREICSEKRVLDGFCLYEEVEKTGCLSSIDIDIYSILLAGLCQQGHSAEAARLARSMLE 442 Query: 183 RRIHLEPSHCENLIK 227 +RI L H E +++ Sbjct: 443 KRIPLRAPHVEKIVE 457 >gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsutum] gi|227463014|gb|ACP39959.1| pentatricopeptide repeat protein [Gossypium hirsutum] Length = 288 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/82 (41%), Positives = 54/82 (65%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + EGRVLDGF L+ E+E++ + S+D DIYS LL LC+++ EA L +M+ Sbjct: 195 MIREICHEGRVLDGFCLYNEIERMQYISSIDTDIYSILLVGLCRQSHSVEAVKLARLMLR 254 Query: 183 RRIHLEPSHCENLIKLWSSSSN 248 RRI LE + + +IK +S++ Sbjct: 255 RRIRLEAPYVDEIIKHLKNSTD 276 >ref|XP_007039757.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676515|ref|XP_007039758.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676519|ref|XP_007039759.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590676523|ref|XP_007039760.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777002|gb|EOY24258.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777003|gb|EOY24259.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777004|gb|EOY24260.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777005|gb|EOY24261.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 483 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/75 (42%), Positives = 51/75 (68%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + EGRVLDGF L++E+E++ L S+D DIYS LL LC+++ EA L M+E Sbjct: 382 MIREICQEGRVLDGFYLYEEIERMRYLSSIDADIYSILLVGLCRQSHSVEAAKLARSMLE 441 Query: 183 RRIHLEPSHCENLIK 227 +RI L+ + + +I+ Sbjct: 442 KRIRLKAPYVDKIIE 456 >gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] Length = 474 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/82 (36%), Positives = 53/82 (64%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + GRVLDG++L E+EK+G S+D D+YS L+ LCQ+ L EA LVS+M++ Sbjct: 381 VIKELCLIGRVLDGYQLCDEIEKIGFWSSIDSDVYSLLIVGLCQQGHLVEAANLVSLMLK 440 Query: 183 RRIHLEPSHCENLIKLWSSSSN 248 + I L + + ++++ S + Sbjct: 441 KGIQLSAPYVDRIVEILKKSGD 462 >ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] gi|449505643|ref|XP_004162530.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] Length = 475 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/75 (42%), Positives = 49/75 (65%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + E RVLDGF L EV++ G L S+D DIYS LL LC+ + +A L +M++ Sbjct: 382 MIRELCLEERVLDGFNLCYEVDRNGYLCSIDADIYSLLLVGLCEHDHSVDAAKLARLMLK 441 Query: 183 RRIHLEPSHCENLIK 227 + I L+P + E++IK Sbjct: 442 KGIRLKPHYAESIIK 456 >ref|XP_007212439.1| hypothetical protein PRUPE_ppa016777mg, partial [Prunus persica] gi|462408304|gb|EMJ13638.1| hypothetical protein PRUPE_ppa016777mg, partial [Prunus persica] Length = 394 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/82 (37%), Positives = 52/82 (63%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++++V EGRV+DGF LF E+EK+ L S+D D YS LL LC++ L EA L +M+ Sbjct: 307 MLKKVCLEGRVIDGFCLFDELEKMECLSSIDSDTYSILLVGLCEQRHLLEAAKLARLMLN 366 Query: 183 RRIHLEPSHCENLIKLWSSSSN 248 + I L+ + +++ ++ S + Sbjct: 367 KGIKLKAPYVDSIAEILKKSGD 388 >ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895520|ref|XP_006440248.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895522|ref|XP_006440249.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542509|gb|ESR53487.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542510|gb|ESR53488.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542511|gb|ESR53489.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] Length = 475 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/75 (38%), Positives = 51/75 (68%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + G+VL+GF L++++EK+G L SVD DI+S LL LC++N EA L M++ Sbjct: 382 MIRELCLRGQVLEGFCLYEDIEKIGFLSSVDSDIHSVLLLGLCRKNHSVEAAKLARFMLK 441 Query: 183 RRIHLEPSHCENLIK 227 +RI L+ + + +++ Sbjct: 442 KRIWLQGPYVDKIVE 456 >ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Citrus sinensis] gi|568846596|ref|XP_006477136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Citrus sinensis] gi|568846598|ref|XP_006477137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X3 [Citrus sinensis] Length = 475 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/75 (38%), Positives = 51/75 (68%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 ++R + G+VL+GF L++++EK+G L SVD DI+S LL LC++N EA L M++ Sbjct: 382 MIRELCLGGQVLEGFCLYEDIEKIGFLSSVDSDIHSVLLLGLCRKNHSVEAAKLARFMLK 441 Query: 183 RRIHLEPSHCENLIK 227 +RI L+ + + +++ Sbjct: 442 KRIWLQGPYVDKIVE 456 >ref|XP_002531466.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528920|gb|EEF30916.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 518 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/75 (37%), Positives = 48/75 (64%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + RVLDG+ L E+EK+G+L ++D D YS LL LCQ+ EA L ++E Sbjct: 381 MIKELCFVNRVLDGYCLHDEIEKIGSLSTIDSDTYSVLLVGLCQQGYSLEAAKLARSLIE 440 Query: 183 RRIHLEPSHCENLIK 227 +RIHL+ + + +++ Sbjct: 441 KRIHLKHPYVDKVVE 455 >ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cicer arietinum] Length = 477 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/74 (40%), Positives = 46/74 (62%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + RVLDGF L +E G L S+D DIYS LL LC+EN L EA L ++M++ Sbjct: 382 LLKEFCLKDRVLDGFYLLDAIENKGFLSSIDSDIYSILLVGLCRENHLMEATKLATIMLK 441 Query: 183 RRIHLEPSHCENLI 224 + + L P + ++ I Sbjct: 442 KGVSLRPPYRDSAI 455 >ref|XP_007131288.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] gi|561004288|gb|ESW03282.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] Length = 474 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/94 (32%), Positives = 52/94 (55%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + + +VLDGF L + +E G L ++D IYS LL LCQ N L EA L +M++ Sbjct: 379 LLKELCMKDQVLDGFHLLEAMENKGCLSTIDNGIYSILLVGLCQRNHLTEATKLAKIMLK 438 Query: 183 RRIHLEPSHCENLIKLWSSSSN*YVNMQVLCASK 284 + + L+P + + I + S + Q+ C K Sbjct: 439 KSVPLQPPYKDGAIDILIKSGEKDLVNQLTCIRK 472 >ref|XP_003604902.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505957|gb|AES87099.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 449 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/76 (38%), Positives = 46/76 (60%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + + RVLDGF L +E +G L S+D DIYS +L L Q+N L EA L +M++ Sbjct: 357 LLKELCLKDRVLDGFYLLDTIENMGFLSSIDSDIYSIMLIGLWQKNHLTEATKLAKIMLK 416 Query: 183 RRIHLEPSHCENLIKL 230 + I L P + + I + Sbjct: 417 KAIPLRPPYKDRAIDI 432 >gb|EPS63367.1| hypothetical protein M569_11418 [Genlisea aurea] Length = 484 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/75 (37%), Positives = 45/75 (60%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +VR VS+GR +DG+ L +E+ GNL D + S LL++LC E+R +EA + +M E Sbjct: 391 VVRAAVSDGRPMDGYVLLDALERSGNLWGADSETCSVLLAALCSESRFEEARKVFDIMKE 450 Query: 183 RRIHLEPSHCENLIK 227 I + S E++ + Sbjct: 451 ASIRFDCSRAESVFE 465 >ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Vitis vinifera] Length = 638 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/75 (40%), Positives = 46/75 (61%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + EGRVLDGF LF E E + L +D DIYS LL L Q+ EA L +MV+ Sbjct: 378 LIKALCLEGRVLDGFHLFDEFENMEGLSYLDSDIYSILLVGLSQKRHSVEAVKLARLMVD 437 Query: 183 RRIHLEPSHCENLIK 227 R I L+ + +++++ Sbjct: 438 RGIQLKTPYFDSIVE 452 >emb|CBI25851.3| unnamed protein product [Vitis vinifera] Length = 528 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/75 (40%), Positives = 46/75 (61%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 +++ + EGRVLDGF LF E E + L +D DIYS LL L Q+ EA L +MV+ Sbjct: 384 LIKALCLEGRVLDGFHLFDEFENMEGLSYLDSDIYSILLVGLSQKRHSVEAVKLARLMVD 443 Query: 183 RRIHLEPSHCENLIK 227 R I L+ + +++++ Sbjct: 444 RGIQLKTPYFDSIVE 458 >ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Solanum tuberosum] Length = 487 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/73 (39%), Positives = 47/73 (64%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 I+R + + R+LDG+ L +E+ ++ S+D DIYS L++ LC+ N L EA L +MVE Sbjct: 387 IIRWLCQQNRILDGYHL---IEQSASVSSIDSDIYSILMAGLCEANHLAEAAKLAHLMVE 443 Query: 183 RRIHLEPSHCENL 221 +RI L+ +N+ Sbjct: 444 KRIQLKGPCVKNV 456 >ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Solanum tuberosum] Length = 488 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/73 (39%), Positives = 47/73 (64%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 I+R + + R+LDG+ L +E+ ++ S+D DIYS L++ LC+ N L EA L +MVE Sbjct: 387 IIRWLCQQNRILDGYHL---IEQSASVSSIDSDIYSILMAGLCEANHLAEAAKLAHLMVE 443 Query: 183 RRIHLEPSHCENL 221 +RI L+ +N+ Sbjct: 444 KRIQLKGPCVKNV 456 >ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Solanum lycopersicum] Length = 480 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/66 (42%), Positives = 43/66 (65%) Frame = +3 Query: 3 IVRRVVSEGRVLDGFRLFQEVEKLGNLLSVDPDIYSSLLSSLCQENRLDEAGWLVSVMVE 182 I+R + + R+LDG+ L +E+ ++ S+D DIYS L++ LC N L EA L +MVE Sbjct: 391 IIRWLCQQNRILDGYHL---IEQSASVSSIDSDIYSVLMAGLCDANHLAEAANLAHLMVE 447 Query: 183 RRIHLE 200 +RI L+ Sbjct: 448 KRIQLK 453