BLASTX nr result
ID: Mentha25_contig00011218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011218 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349612.1| PREDICTED: cytochrome c biogenesis protein C... 68 2e-09 ref|XP_004248727.1| PREDICTED: cytochrome c biogenesis protein C... 68 2e-09 ref|XP_004292042.1| PREDICTED: cytochrome c biogenesis protein C... 67 3e-09 gb|EYU37756.1| hypothetical protein MIMGU_mgv1a006775mg [Mimulus... 65 8e-09 ref|XP_006487198.1| PREDICTED: cytochrome c biogenesis protein C... 62 1e-07 ref|XP_006423193.1| hypothetical protein CICLE_v10028141mg [Citr... 62 1e-07 ref|XP_007200960.1| hypothetical protein PRUPE_ppa003510mg [Prun... 62 1e-07 ref|XP_007131864.1| hypothetical protein PHAVU_011G047800g [Phas... 60 4e-07 ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein C... 60 4e-07 gb|EPS63374.1| hypothetical protein M569_11409, partial [Genlise... 59 5e-07 ref|XP_003537900.1| PREDICTED: cytochrome c biogenesis protein C... 59 5e-07 ref|XP_007042720.1| Cytochrome c biogenesis protein family isofo... 57 3e-06 >ref|XP_006349612.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like [Solanum tuberosum] Length = 557 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +VVGGKTNRAKGEFP+ MN LLDQVPE+V+SS+P++P +SG Sbjct: 515 VVVGGKTNRAKGEFPDTMNRLLDQVPELVESSSPEEPNILSG 556 >ref|XP_004248727.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like [Solanum lycopersicum] Length = 561 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +VVGGKTNRAKGEFP+ MN LLDQVPE+V+SS+P++P +SG Sbjct: 519 VVVGGKTNRAKGEFPDTMNRLLDQVPELVESSSPEEPNILSG 560 >ref|XP_004292042.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 556 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +V+GGKTNRAKGEFPE+MN LLD+VPE++DSS KQ S+SG Sbjct: 515 VVIGGKTNRAKGEFPEEMNRLLDRVPELIDSSLSKQADSISG 556 >gb|EYU37756.1| hypothetical protein MIMGU_mgv1a006775mg [Mimulus guttatus] Length = 432 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +VVGG+TNR+KGEFP+DMN+LLDQVPE++DSSA Q + + G Sbjct: 391 VVVGGRTNRSKGEFPDDMNFLLDQVPELIDSSASNQSEIIGG 432 >ref|XP_006487198.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like [Citrus sinensis] Length = 545 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +++GGKTNRAK EFP+DMN LLD+VPE+V+SS KQ +SG Sbjct: 504 VIIGGKTNRAKAEFPDDMNRLLDRVPELVESSRSKQSDGISG 545 >ref|XP_006423193.1| hypothetical protein CICLE_v10028141mg [Citrus clementina] gi|557525127|gb|ESR36433.1| hypothetical protein CICLE_v10028141mg [Citrus clementina] Length = 545 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +++GGKTNRAK EFP+DMN LLD+VPE+V+SS KQ +SG Sbjct: 504 VIIGGKTNRAKAEFPDDMNRLLDRVPELVESSLSKQSDGISG 545 >ref|XP_007200960.1| hypothetical protein PRUPE_ppa003510mg [Prunus persica] gi|462396360|gb|EMJ02159.1| hypothetical protein PRUPE_ppa003510mg [Prunus persica] Length = 569 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 ++VGGKTNRAKGEFPE+MN LLD+VPE+V+SS +Q S+ G Sbjct: 528 VIVGGKTNRAKGEFPEEMNRLLDRVPELVNSSLSRQSDSIVG 569 >ref|XP_007131864.1| hypothetical protein PHAVU_011G047800g [Phaseolus vulgaris] gi|593146516|ref|XP_007131865.1| hypothetical protein PHAVU_011G047800g [Phaseolus vulgaris] gi|561004864|gb|ESW03858.1| hypothetical protein PHAVU_011G047800g [Phaseolus vulgaris] gi|561004865|gb|ESW03859.1| hypothetical protein PHAVU_011G047800g [Phaseolus vulgaris] Length = 566 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 472 VGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 VGGKTNRAK EFPE+MN LLD+VPEIV+S+ KQ S+SG Sbjct: 527 VGGKTNRAKIEFPEEMNRLLDKVPEIVESTLSKQADSISG 566 >ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic [Vitis vinifera] gi|297741415|emb|CBI32546.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 +V+GGKTNRAK EFP++MN LLD+VPE+V+SS KQ ++SG Sbjct: 516 VVIGGKTNRAKLEFPDEMNQLLDRVPELVESSLSKQSDAISG 557 >gb|EPS63374.1| hypothetical protein M569_11409, partial [Genlisea aurea] Length = 457 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDS 386 +VVGGKTNRAKGEFP +MN+LLDQVPEIVDS Sbjct: 427 VVVGGKTNRAKGEFPGEMNFLLDQVPEIVDS 457 >ref|XP_003537900.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X1 [Glycine max] gi|571488334|ref|XP_006590903.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X2 [Glycine max] gi|571488336|ref|XP_006590904.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X3 [Glycine max] gi|571488338|ref|XP_006590905.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic-like isoform X4 [Glycine max] Length = 563 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 472 VGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQPKSMSG 353 VGGKTNRAK EFPE+M+ LLD+VPEIV+S+ PK S+SG Sbjct: 524 VGGKTNRAKMEFPEEMSRLLDKVPEIVESNLPKHADSISG 563 >ref|XP_007042720.1| Cytochrome c biogenesis protein family isoform 1 [Theobroma cacao] gi|508706655|gb|EOX98551.1| Cytochrome c biogenesis protein family isoform 1 [Theobroma cacao] Length = 544 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 478 LVVGGKTNRAKGEFPEDMNYLLDQVPEIVDSSAPKQP 368 ++VGGKTNRAK EFP++MN LLD VPEIV SS +QP Sbjct: 507 VIVGGKTNRAKAEFPDEMNRLLDLVPEIVQSSISEQP 543